SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000014792 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000014792
Domain Number 1 Region: 253-457
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 9.22e-69
Family PDEase 0.0000411
Further Details:      
 
Domain Number 2 Region: 65-248
Classification Level Classification E-value
Superfamily GAF domain-like 1.57e-44
Family GAF domain 0.000000184
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000014792
Domain Number - Region: 28-78
Classification Level Classification E-value
Superfamily GAF domain-like 0.0108
Family GAF domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000014792   Gene: ENSOANG00000009297   Transcript: ENSOANT00000014795
Sequence length 473
Comment pep:novel supercontig:OANA5:Contig19971:312:16059:1 gene:ENSOANG00000009297 transcript:ENSOANT00000014795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSSLMPSWLPQGLCPSPWPQSLSSFARYTDEDEHKILHCFCYTSTVLTSTLAFQKEQKL
KCECQALLQVAKNLFTHLDDVSVLLQEIISEARNLSNAEICSVFLLDRLNHELVAKVFDG
GVVDDEGGELSIPADQGIAGHVATPTILNIKDAYSHPLFYRGVDDSTGFRTRNILCFPIK
DENHEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLAN
EMMMYHMKVSDDEYTKLLRDGIQPVAAIDSNFACFTYTPRSLPEDDTSMAILSMLQDMNF
INNYKIDRQTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELAKYLEDIEIFA
LFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTQGCNIFDH
FSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQRMAEGMASLAQAFPTCDPGS
Download sequence
Identical sequences F7EIH6
ENSOANP00000014792 ENSOANP00000014792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]