SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000014898 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000014898
Domain Number 1 Region: 495-834
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.77e-111
Family PDEase 0.0000003
Further Details:      
 
Domain Number 2 Region: 56-250
Classification Level Classification E-value
Superfamily GAF domain-like 1.07e-33
Family GAF domain 0.00034
Further Details:      
 
Domain Number 3 Region: 237-289,321-458
Classification Level Classification E-value
Superfamily GAF domain-like 8.41e-30
Family GAF domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000014898   Gene: ENSOANG00000009367   Transcript: ENSOANT00000014901
Sequence length 861
Comment pep:novel chromosome:OANA5:X1:12766609:12824416:-1 gene:ENSOANG00000009367 transcript:ENSOANT00000014901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEVTSEEVEKFLDSNFVFAKQYYDRRFRAKVISELLGPKETSVDFSHYHTLTSAEESEI
VFELLRDLQENLQAEKCIFTVTKRLCFLLHADRMSLFMYRTRNAVAELATRLFNVHKDAV
LEDCLVAPDSEIVFPLDMGVVGHVAHSKKIVNVPNTAEDDRFCDFVDVLTEYETKNILAA
PIMNGKDVVAVVMAVNKVDGPHFTKSDEEILLKYLNFANLIMKVFHLSYLHNCETRRGQV
LLWSGSKVFEELTDIERQFHKALYTVRAFLNCDRYSVGLLDMTKQKEFFDVWPVLMGEAP
PYSGPRTPDGREINFYKVIDYILHGKEDIKVIPNPTPDHWALVSGLPTYVAQNGLICNIM
NAPAEDFFAFQKEPLDESGWTIKNVLSMPIVNKKEEIIGVATFYNRKDGKPFDDMDETLM
ESLTQFLGWSVLNPDTYESMNKLQNRKDIFQDMVKYHVKCSNDEIQEILKTREVYGKEPN
ECEEDELFEILQAELPDPEQYEINQFHFSDLPLTELELVKCGIQMYYELKVVDKFHIPQE
ALVRFIYSLSKGYRKITYHNWRHGFNVGQTMFSLLTTGKLKRYFTDLEALAMVTAAFCHD
IDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKTLLKDESLNIFQNLNRRQHEHAIH
MMDIAIIATDLALYFKKRTMFQKIVDQSKTYESEQEWTQYMMLEQTRKEIVMAMMMTACD
LSAITKPWEVQSKVALLVAAEFWEQGDLERSVLQQNPIPMMDRNKADELPKLQVGFIDFV
CTFVYKEFSRFHDQITPMLEGITNNRKEWKALADEYEAKMKALEEEKQKQETSKKAAAGN
PAGGNSATGEGTTQSKSCSLQ
Download sequence
Identical sequences F7G5L8
ENSOANP00000014898 9258.ENSOANP00000014898 XP_001506083.1.37387 ENSOANP00000014898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]