SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000016709 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000016709
Domain Number 1 Region: 1-322
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.16e-75
Family L-arabinose binding protein-like 0.00034
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000016709
Domain Number - Region: 439-472
Classification Level Classification E-value
Superfamily GAF domain-like 0.0235
Family Phytochrome-specific domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000016709   Gene: ENSOANG00000010544   Transcript: ENSOANT00000016712
Sequence length 606
Comment pep:novel supercontig:OANA5:Contig23643:11619:18388:-1 gene:ENSOANG00000010544 transcript:ENSOANT00000016712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QITYGPFDLVLSDKIQFPSLYQVAPRISSLPWVMVQLMVHFGWTWVGLVVSDDMRGESFL
LDVTGETARNGVCVAFTKKMSSVRFSTYLVQELYARIMASSANVIAAYGVAESLHPLRSV
IESFGLSKMVLITTYHWDFTSSMIHETNNNHFHGTLTMVNFAKEVPGFRDFLQSIRPANY
PDTIILKKFWESVFDCAFSLHYFSLMLSSLSYNVYNAVYAVAHAIQELLLSKSDVKSWGN
SKREKEHCPNFHEFLRNVQFDNPAGQLVILDENSRSSAKFDIMNFVIFPSGTGEFVKVGE
VDPQAPPNQEVSINEAMIVWPGGASQNYRCICSNKINRIINMCIYKQELWCCLVILSICP
TPRFTYHIYHMMPRDTSLVPSSKISPCPRRAWSPGCSMAVRGVGGILTELGCSLNPCSKT
WVYHGGSWGPGVLKKVEITRDWLLWFRAHVERALTWHGSPWSSAWAGAGNGSVTLAIVSP
GECDPHIVTGEFLLRNSVTAFYCVLGLAFLALVSFTMAFLVRLPDSFNEAKFITFGMLVF
CSVWAFLPSYQSTKGKATVAMEIFSILTSSAGVLSCIFIPKCYVILVQPDRNTQIAGHKE
KEKSCQ
Download sequence
Identical sequences F6U789
9258.ENSOANP00000016709 ENSOANP00000016709 ENSOANP00000016709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]