SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000017734 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000017734
Domain Number 1 Region: 8-238
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.05e-90
Family Calponin-homology domain, CH-domain 0.000000909
Further Details:      
 
Domain Number 2 Region: 2184-2300
Classification Level Classification E-value
Superfamily PH domain-like 2.1e-37
Family Pleckstrin-homology domain (PH domain) 0.00000245
Further Details:      
 
Domain Number 3 Region: 257-378
Classification Level Classification E-value
Superfamily Spectrin repeat 7.59e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 4 Region: 973-1128
Classification Level Classification E-value
Superfamily Spectrin repeat 4.08e-29
Family Spectrin repeat 0.0000243
Further Details:      
 
Domain Number 5 Region: 601-705
Classification Level Classification E-value
Superfamily Spectrin repeat 6.12e-28
Family Spectrin repeat 0.00018
Further Details:      
 
Domain Number 6 Region: 1185-1338
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-27
Family Spectrin repeat 0.00051
Further Details:      
 
Domain Number 7 Region: 1714-1866
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-27
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 8 Region: 866-1013
Classification Level Classification E-value
Superfamily Spectrin repeat 9.81e-27
Family Spectrin repeat 0.00086
Further Details:      
 
Domain Number 9 Region: 775-913
Classification Level Classification E-value
Superfamily Spectrin repeat 2.04e-26
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 10 Region: 1448-1552
Classification Level Classification E-value
Superfamily Spectrin repeat 2.64e-24
Family Spectrin repeat 0.00027
Further Details:      
 
Domain Number 11 Region: 387-490
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 12 Region: 1556-1657
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-22
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 13 Region: 1874-1973
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-22
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 14 Region: 491-599
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-22
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 15 Region: 708-809
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-21
Family Spectrin repeat 0.00053
Further Details:      
 
Domain Number 16 Region: 1346-1444
Classification Level Classification E-value
Superfamily Spectrin repeat 5.61e-18
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 17 Region: 1946-2039
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000576
Family Spectrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000017734   Gene: ENSOANG00000011193   Transcript: ENSOANT00000017737
Sequence length 2354
Comment pep:known ultracontig:OANA5:Ultra56:217204:288651:1 gene:ENSOANG00000011193 transcript:ENSOANT00000017737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWSQTKLFLLPDEREAVQKKTFTKWVNSHLARVSCRITDLYADLRDGRMLIKLLEVLSGE
RLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQ
IQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPD
LIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFS
KMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQ
QQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWER
LEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVE
AATKKHEAIETDIAAYEERVQAVVAVAKELEAENYHDIKRITARKDNVIRLWEYLLELLR
ARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIG
IQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMDFCYQELCQLAAERRARLEESR
RLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLLSKHRAFEDEMSGRSGHFEQAI
KEGEDMIAEEHFGAEKIRERIGYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDA
WMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEIANYRPAIDSLHEQAGALPREHAESP
DVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNSMQIP
EKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWS
QFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKL
TGMERDLVAIEAKLTDLQKEAEKLESEHPDQAQAILSRLAEINDVWEEMKTTLKNREASL
GEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTMAEAEKLLTQHENIKNEINNYEEDY
QKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDT
KQAEAFLNNQEYVLAHTEMPTTLEAAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSD
GNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTA
QDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEQEGMQLIAEKPETEAVVKEKLTGL
HKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLNGLESQIQSDDYGKDLTSVNIL
LKKQQMLENQMDVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLTERK
SNLLASKEIHQFNRDVEDEILWVGERMPIATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQ
PRIDDIYERSQNILTDSSLSAEAIRQRLADLKQLWNLVIEETEKRHRRLEESHKAQQYYF
DAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALV
ADNHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREV
VAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHMADDLINSGHSDAATIAEW
KDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTV
ETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKALLDA
CEGRRPLVDTGDKFRFFSLVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEI
DARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVH
QFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLT
TLELLEVRRQQEEEERKRQPPSPEPSTKVSEEAESQQQCKRTMRSSWEGKRQATDGSTMV
SGVSISCTNTTQSAKELVPLEATQVPVQSGPLAETAETSEMVNGATEQRTSSKESSPVPS
PTSDRKAKTVLQAQTAATLPAKTQEVPAAQMEGFLNRKHEWEAHNKKASSRSWHNVYCVI
NNQEMGFYKDAKAASSGIPYHNEIPVSLKEAVCEVALDYKKKKHVFKLRLNDGNEYLFQA
KDDEEMSTWIQAITSAISSDKMDVSASTQSTPASSRAQTLPASVTITSESSPGKREKDKE
KDKEKRFSLFGKKK
Download sequence
Identical sequences F7FJS9
ENSOANP00000017734 ENSOANP00000017734 9258.ENSOANP00000017734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]