SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000018396 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000018396
Domain Number 1 Region: 2741-3000
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-71
Family Protein kinases, catalytic subunit 0.00000274
Further Details:      
 
Domain Number 2 Region: 1912-2108
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-54
Family DBL homology domain (DH-domain) 0.0000129
Further Details:      
 
Domain Number 3 Region: 1247-1425
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.59e-52
Family DBL homology domain (DH-domain) 0.00000000799
Further Details:      
 
Domain Number 4 Region: 2110-2232
Classification Level Classification E-value
Superfamily PH domain-like 1.96e-33
Family Pleckstrin-homology domain (PH domain) 0.00068
Further Details:      
 
Domain Number 5 Region: 1429-1547
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-32
Family Pleckstrin-homology domain (PH domain) 0.000000529
Further Details:      
 
Domain Number 6 Region: 2634-2729
Classification Level Classification E-value
Superfamily Immunoglobulin 3.66e-22
Family I set domains 0.0083
Further Details:      
 
Domain Number 7 Region: 264-400
Classification Level Classification E-value
Superfamily Spectrin repeat 5.28e-21
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 8 Region: 1061-1198
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-20
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 9 Region: 811-964
Classification Level Classification E-value
Superfamily Spectrin repeat 3.5e-19
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 10 Region: 485-626
Classification Level Classification E-value
Superfamily Spectrin repeat 2.57e-18
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 11 Region: 2497-2562
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000609
Family SH3-domain 0.0002
Further Details:      
 
Domain Number 12 Region: 1598-1689
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000194
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 13 Region: 20-173
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000000183
Family CRAL/TRIO domain 0.011
Further Details:      
 
Domain Number 14 Region: 631-738
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000012
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 15 Region: 178-294
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000563
Family Spectrin repeat 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000018396   Gene: ENSOANG00000011610   Transcript: ENSOANT00000018399
Sequence length 3046
Comment pep:novel supercontig:OANA5:Contig22:3564360:3840260:1 gene:ENSOANG00000011610 transcript:ENSOANT00000018399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVSLYIAGFRKNDEMKAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRIRQEDLR
RLISYLACIPSEEVCKRGFTVIVDMRGSKWDSIKPLLKILQESFPCCIHVALIIKPDNFW
QKQRTNFGSSKFEFETNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVAFEDYIS
SATHMLSRLEELQDILAKKELPQDLEGARNMIDEHSQLKKKVIKAPIEDLDLEGQKLLQR
IQSSDSFPKKNSGSGNADLQNLLPKVSTMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLF
EQDAEKMFDWITHNKGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINRIMSVA
NRLVESGHYASQQIKQIANQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMSNVDSWC
KACGEVELPSELQDLEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLT
ASANYSKAVHHVLDVIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENH
GEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEI
YQAAHQLEDRIQDFVRRVEQRKILLDMSVSFHTHVKELWTWLEELQKELLDDVYAESVEA
VQDLIKRFGQQQQTTLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLD
EAQSQMEELFQERKIKLELFLQLRIFERDAIDIISDLESWNDELSQQMNDFDTEDLTIAE
QRLQHHADKALTMNNLTFDVIHQGQDLLQYVNEVQASGVELLCDRDVDMATRVQDLLEFL
HEKQQELDLVSEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQ
LQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMED
RLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLE
QKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQRENRVLH
YWTMRKRRLDQCQQYVVFERSAKQALEWIHDSGEFYLSTHTSTGSSIQHTQELLKEHEEF
QITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKA
LGISSDSNKSSKSLQLDIIPASVPGSEVKLRDAAHELNEEKRKSARRKEFIMAELIQTEK
AYVRDLRECMDTYLWEMTSGVEEIPPGIVNKEHIIFGNMQEIYEFHNNIFLKELEKYEQL
PEDVGHCFVTWADKFQMYVTYCKNKPDSTQLILEHAGSYFDEIQQRHGLANSISSYLIKP
VQRITKYQLLLKELLTCCEEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGFDENIESQGE
LILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVT
EHVEGDPCKFALWVGRTPTSDNKIVLKASSIENKQDWIKHIREVIQERTIHLKGALKEPI
HIPKTAPTAKQKGRRDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIH
DFTACNSNELTIRRGQTVEVLERPHDKPDWCLVRTTDRSPAAEGLVPCGSLCIAHSRSSM
EMEGIFNHKDSLSVSSNDASPPASVTSLQPHMIGAQSSPGPKRPGNTLRKWLTSPVRRLS
SGKADGHVKKLAHKHKKSREVRKSADAGSQKDSDDSAATPQDETIEERGRNEGLSSGTLS
KSSSSGMQSCGEEEGEEGADAVPLPPPMAIQQHSLLQPDSQDDKTSSRLLVRPTSSETPS
AAELVSAIEELVKSKMALEDRPSSLLVDHGDSSSPSFNPSDNSLLSSSSPIDEMEERKSS
SLKRRHYVLQELVETERDYVRDLGYVVEGYMALMKEDGVPDDMKGKDKIVFGNIHQIYDW
HRDFFLGELEKCLEDPEKLGSLFVKHERRLHMYIVYCQNKPKSEHIVSEYIDTFFEDLKQ
RLGHRLQLTDLLIKPVQRIMKYQLLLKDFLKYSKKANLDTTELERAVEVMCIVPKRCNDM
MNVGRLQGFDGKIVAQGKLLLQDTFLVTDQDAGLLPRCKERRVFLFEQIVIFSEPLDKKK
GFSMPGFLFKNSIKVSCLCMEENVDNDPCKFALTSRTADVLETFVLHSSSPGVRQTWIHE
INQILENQRNFLNALTSPIEYQRNHSGGGGGGPGGGPGIGNSSGGSGSGRSGRPGSRSPS
DTTPQSWSPLQPRPRQRQTRCQVRPSTTPPATLQQQQHLPRPRPRPAKPTASRGPARGAR
ERSGPADPEDESPREPAEGVRERPRPGAGRSAQGGPGELGGEPRQEQPGGSDAGQAQTRR
RLARELAAALPRVPRSLWKGGVPAQQPPAEGGSFWSSIPASPASRPGSFTFPGDSDSLQR
QVHRHSAHSKDTDRMSTCSSTSEQSVHSTQSNGSESSSSSNISTMLVTHDYTAVKEDEIN
VYQGEVVQILASNQQNMFLVFRAATDQCPAAEGWIPGYVLGHTSAVIIDNPDGTIKKSTS
WHTALRLRKKSEKKDKDGKREGKLENGYRKSREGLTNKVSVKLLNPNYIYDVPPEFIIPL
SEVTCETGETIVFRCKVCGRPKASVTWKGPEHNTLNNDGHYSISYSDLGEATLKIIGVTT
EDDGIYTCIAVNDMGSVSSSASLRVLGPGSDGIMVIWKDNFDSLFSEVAELGRGRFSVVK
KCDQRGTKRSVATKFVNKKLMKRDQVTHELGVMQNLQHPLLVGLLDTFETSTSYVLVLEM
ADQGRLLDCVVRWGNLTEGKISMYLGEILEAVQYLHNCRIVHLDLKPENILVDQSSAKPT
IKLADFGDAVQLNTTYYIHQLLGSPEFAAPEIILGNPVSLTSDIWSIGVLTYVLLSGVSP
FLDDSVEETCLNICRLDFSFPDDYFKGVSQKAKDFVCFLLQDDPAKRPSAALSLQEPWLQ
LGHGKSADSIDTSRLTSFIERRKHQNDVRPIRSIKNFLQSRLLPRV
Download sequence
Identical sequences F6YHT8
ENSOANP00000018396 9258.ENSOANP00000018396 ENSOANP00000018396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]