SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000018469 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000018469
Domain Number 1 Region: 571-758
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.26e-51
Family DBL homology domain (DH-domain) 0.000000108
Further Details:      
 
Domain Number 2 Region: 762-893
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-35
Family Pleckstrin-homology domain (PH domain) 0.00000202
Further Details:      
 
Domain Number 3 Region: 995-1057
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000276
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 4 Region: 289-407
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000144
Family Spectrin repeat 0.012
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000018469
Domain Number - Region: 92-177
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000183
Family CRAL/TRIO domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000018469   Gene: ENSOANG00000011658   Transcript: ENSOANT00000018472
Sequence length 1077
Comment pep:novel chromosome:OANA5:6:6036474:6123033:1 gene:ENSOANG00000011658 transcript:ENSOANT00000018472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACAELLEEYGGTAVPICAKDINDHLMKKFAFLSGGRGKDNDWIITFPEYAHFREVPEDV
LTKVLTYLTSVPRQHEPDIKFTLILDRRLDTWASVKMTLQRIAASFPGNLHLVMVLRPTG
FIQRTFTDIGFRFSQEDFILKLPVVMLSSVSDLLTYIDEKQLTPEFGGTLEYCHSEWVIF
RTAIESFALTVKEVAQMLQSFGTELAERELPDDIYSLERILAVRTEKYYQLKEDITTVMH
EGNMLLRNLEVPDTRDSSQETPQEKTGDWDTVNRLLAQLHEMETAFDGFWEKHQLKMEQY
LQLCKFEQSFQELKNTIEFLMAQQVELPVTGENVSEVKQRLTDLGNLDEMAQELIGKAQI
VILHGHQLAANHHYALDLICQRCNELRHLSDVLTDEIKAKQVQLSKTLELHSRLQQALAC
CDEGAYLLANQQMDKCQSKEGAQQALQDIEKFLETSLPCLNYDPQVLQYDFESILTPELK
AQIQSVQIKLENVRSMFESRQACFKKLTDKQVRPVQLVAPRPENTSRSRSPLFSPKHGKK
TSRKSQTSRKIEVMHDYQEKRNSLQSQSDDNLDILKSHVINELIETERVYVEELFTVLMG
YRAEMDNPVMLFLMPPALRNRQDILFGNMPEIYDFHNSIFLHSLESCVGAPERVGFCFLE
RREDFQMYEKYCQNKPRSELLWRQCSESTFFQECQKKLEHKLGLDSYLLKPVQRLTKYQL
LLKELLKYSSSCEGVQELQEALIAMLDLLKSVNDSMHQISITGYDGDLTDLGKILMQGSF
SVWIGHRKGATKMKDLARFKPMQRHLFLYEKAIMFCKKREEHGDGYDKTSSYSFKHYLKM
NAVGITENIKGDHRKFEIWYSGREEVYVVQAQTVEMKMAWLNEIRKVLFKQQELIKGKKI
EKQQYQLTDQVQLSPQLNDRKQPRVSVSSEENESDRTSPIMLDSVLLSPQHKPDKSWPGM
SQSVELCEGLEEWATNSYLSTCSDTEEEDGSQLSPGKYKALADYKALADCKTKGSEDLLV
KNGDVIQLLHEDAEGHWLVKNINRKKEGLIPGNSLQVLIGDCRFRNAKIADAALSNT
Download sequence
Identical sequences F6S6X7
ENSOANP00000018469 ENSOANP00000018469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]