SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000018986 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000018986
Domain Number 1 Region: 743-890
Classification Level Classification E-value
Superfamily Spectrin repeat 1.94e-39
Family Spectrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 205-360
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-36
Family Spectrin repeat 0.00014
Further Details:      
 
Domain Number 3 Region: 1719-1866
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-34
Family Spectrin repeat 0.00000254
Further Details:      
 
Domain Number 4 Region: 1827-1981
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-34
Family Spectrin repeat 0.00000185
Further Details:      
 
Domain Number 5 Region: 523-676
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-34
Family Spectrin repeat 0.0000565
Further Details:      
 
Domain Number 6 Region: 1289-1426
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-33
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 7 Region: 106-253
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-32
Family Spectrin repeat 0.00046
Further Details:      
 
Domain Number 8 Region: 1398-1540
Classification Level Classification E-value
Superfamily Spectrin repeat 5.5e-32
Family Spectrin repeat 0.0000292
Further Details:      
 
Domain Number 9 Region: 311-464
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-31
Family Spectrin repeat 0.00077
Further Details:      
 
Domain Number 10 Region: 1611-1758
Classification Level Classification E-value
Superfamily Spectrin repeat 9.82e-31
Family Spectrin repeat 0.00000303
Further Details:      
 
Domain Number 11 Region: 1931-2086
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-28
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 12 Region: 2093-2206
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-26
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 13 Region: 2324-2461
Classification Level Classification E-value
Superfamily EF-hand 3.43e-24
Family Calmodulin-like 0.0046
Further Details:      
 
Domain Number 14 Region: 2208-2323
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-20
Family Spectrin repeat 0.00079
Further Details:      
 
Domain Number 15 Region: 969-1030
Classification Level Classification E-value
Superfamily SH3-domain 6.69e-20
Family SH3-domain 0.0000384
Further Details:      
 
Domain Number 16 Region: 891-962
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-19
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 17 Region: 1062-1166
Classification Level Classification E-value
Superfamily Spectrin repeat 6e-19
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 18 Region: 12-79
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000196
Family Spectrin repeat 0.00013
Further Details:      
 
Domain Number 19 Region: 474-540
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000288
Family Spectrin repeat 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000018986   Gene: ENSOANG00000011986   Transcript: ENSOANT00000018989
Sequence length 2479
Comment pep:novel supercontig:OANA5:Contig1767:10244:68047:-1 gene:ENSOANG00000011986 transcript:ENSOANT00000018989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDADELEKWI
QEKLQIASDENYKDPTNLQGKSRLKHPSRYIHIQGNSSICHITLDHPGNQLISVGWGRRT
LIQTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELG
QDLEHVEVLQKKFEEFQTDMAAHEDRVNEVNQFAAKLIQEQHPEEELIKSKQDEVNAGWQ
RLKGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHE
GLERDLAALEDKVKALCAEADRLQQSHPMSASQIQVKREELIANWEQIRTLAAERHARLN
DSYRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFK
SADESGQALLAAGHYASDEVRDKLSILSEERAALLELWELRRQQYEQCMDLQLFYRDTEQ
VDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNH
YAMEDVATRRDALLSRRNALHDRAMYRRTQLADSFHLQQFFRDSDELKSWVNEKMKTATD
EAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVIS
LWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQK
KHALLEADVAAHQDRIDGITIQARQFQEAGHFDADNIKKKQEALVARYEALKDPMVARKQ
KLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEP
RIKAVTQKGNAMVEEGHFASEDVKAKLNELNQKWESLKAKASQRRQDLEDSLQAQQYFAD
ANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQ
QVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPA
AYVKKLDPAQSASRENLLEEQGSIALRQEQIDNQTLITKEVGSVSLRMKQVEELYHSLLE
LGEKRKGMLEKSCKKFMLFREANELQQWINEKEAALTNEEVGTDLEQVEVLQKKFDDFQK
DLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLM
VHTVATFNSIKELNERWRSLQLLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNT
DNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELN
QAWNSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALL
ERHQEHRTEIDARAGTFQAFEQFGQQLLARGHYASPEIKEKLDILDQERADLEKAWVQRR
MMLDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQE
EKIAALQSFADQLISADHYAKGDISNRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSR
DVDEIEAWISEKLQTASDESYKDPTNIQLSKLLSKHQKHQAFEAELHANADRIRGVIDMG
NSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFW
LSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNGQADSLMTSSAFDTS
QVKDKRDTINGRFQRIKSMAAARRAKLNESHRLHQFFRDMDDEESWIKEKKLLVSSEDYG
RDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQFVEHWK
ELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHE
AFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISAKMKGLNGKVSDLEKAAAQRKAKLD
ENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGI
ANITALKDQLLAAKHIQSKAIEARHASLMKRWHQLLANSATRKKKLLEAQEHFRKVEDLF
LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAEL
DRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQH
ANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAME
EALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFK
HFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMA
FMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTKAXADYCISHMKPYMDSKG
RELPSAFDYIEFTRSLFVN
Download sequence
Identical sequences F7AQ59
ENSOANP00000018986 9258.ENSOANP00000018986 ENSOANP00000018986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]