SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000019321 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOANP00000019321
Domain Number - Region: 30-107
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0194
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000019321   Gene: ENSOANG00000012207   Transcript: ENSOANT00000019324
Sequence length 132
Comment pep:novel supercontig:OANA5:Contig18101:4020:8645:-1 gene:ENSOANG00000012207 transcript:ENSOANT00000019324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKDALGDAGLHFDELNKLRVLDPEVTQQTVELKEECKDFVDKIGQFQKIVGGLIELVDQ
LARDAESEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAE
QNEFIDQFIFQK
Download sequence
Identical sequences F7FPP0
ENSOANP00000019321 XP_001507372.2.37387 ENSOANP00000019321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]