SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000019433 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000019433
Domain Number 1 Region: 2-71
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000504
Family Spectrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000019433   Gene: ENSOANG00000012283   Transcript: ENSOANT00000019436
Sequence length 73
Comment pep:novel supercontig:OANA5:Contig184114:284:502:-1 gene:ENSOANG00000012283 transcript:ENSOANT00000019436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEGQQLMQEKPELAGSVRKKLGEIRQCWAELESTTQAKARQLFEASKADQLVQSFAELDK
RLLHMESQLQDVD
Download sequence
Identical sequences F7DV02
9258.ENSOANP00000019433 ENSOANP00000019433 ENSOANP00000019433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]