SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000020017 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000020017
Domain Number 1 Region: 939-1066
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000916
Family GAF domain 0.02
Further Details:      
 
Domain Number 2 Region: 283-345,771-859
Classification Level Classification E-value
Superfamily EF-hand 0.0000262
Family Calbindin D9K 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000020017   Gene: ENSOANG00000012655   Transcript: ENSOANT00000020020
Sequence length 1362
Comment pep:novel ultracontig:OANA5:Ultra69:1810193:1885500:-1 gene:ENSOANG00000012655 transcript:ENSOANT00000020020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKSEQESQAKELTLPELGKAKNVAFSGEKPQETMRKDFPWKEIFTEKVEERSLALQQK
EVQKRNLQKTREEKMKKKVPIDALTKEWFNDENVTLDTRAYLLDKLLPTLVPGVEKLLME
VEKRKVLETDKIPPRFNSVNFLGEYLMRHNPEFHKVSEVSGYQRGMKEAMEEMKTQVPDT
PLNKIALMKEEVRKKRKWRDQVDEIKSKVKEKRKEALAVQFQEWILDVNGKIPLAIVQNA
LRSFLDTPVGNEAGSYAMALEIVDTLEQRLNEEEFLECVHSHIKDLSSDQFRELLKHFCQ
CTNDFRNVIRHDMWRQMFSDLFQACDTGKIGILDRQRTLSLLENFYDSSPAKARNRFRDP
RKWPVVELEEIEPAELWEDSEDEDSLSEEARGEFSVSQIQVALPAGQSDVALEDLQGSGA
EQGRSDQKSSSNSEASLTSITGDGQQEEVSLEEVTTPIKMSSSEKLSEPTGHLGSSLLGS
ETGSMASQGKSKPAAEQSQADPVEGRMEFQRRSCEGEEGPGGEEAAGEDATELEDASTGE
VVLGEEDVPRGEDTPGEEDAFGGEDDLGEEDDPGEEDAPGGKDSPGEEDATGGVDAPGGE
AEQGNQRMSPDPHQEVSMLQQEDETTGSSPGRISAANSFEGQAHTAKSFEATPQLIDEDL
WSGNLLTSDLSLKYINYGDHTQDALPFDDPRFSDLRLLMADIQAWGETRLRSPFSEKSLK
LPQFVQLLEMFVGEETSLATIKKLTEFFKAGYVETEDEKIEQLEKAHHEAFLARRKLLLR
ALFDKWDNESSGFLDLREVDAVLATFKEGMEKAALKKAKLHILLPKPHPGQEIRLSQKLF
QNYIEMIVAELPGNEDEVMDNMVEFLSASLERSHREQLRGSARRKWLHQVRHAAETSGMN
LEPVYKEIFKALAQDADIHGNKKISAHIALLEQNLLLPERGDVLLRNVACTLDDAPFVLN
KVLYRDMKGISFAVVDQGTPIHVPEVHYHGNVHFWHDSHPEEEQNGSLLVVPLQDSHRRA
FGVLAVDTLRTHYQAQSIFQTHEISFYQGVSRAFSITYHHVHAREHILHVVVTATDWLRN
RAPSIKSITTYLTEPTLGEISDYILRKIMMTDPTGQTEIHTSHAVLCRKENFFRDYLFKC
GDSSEVIVTLAFGEHHIAFPLRETSGRALWVFDINTGHSSLLPSKELRELQKMLKIVQAA
CYEILKEFSGETDKSYVLEIERAGEVKRAGILFYRFMLLELQACIQKLDPQASAQLKDYK
TPPRRMHNILRGVLLLLHPEWAESEELKSWDQCRQKVNGDLIRMVCSFDPTDSSVQVQPD
LIAKYVQGIHRRSVRRCGSILIEYLYNWTLTCLTLLELKKKL
Download sequence
Identical sequences F7BTH2
ENSOANP00000020017 XP_007670750.1.37387 XP_007670751.1.37387 ENSOANP00000020017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]