SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000021795 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000021795
Domain Number 1 Region: 140-194
Classification Level Classification E-value
Superfamily RING/U-box 8.52e-19
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000021795
Domain Number - Region: 85-144
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0129
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number - Region: 25-66
Classification Level Classification E-value
Superfamily Tropomyosin 0.0458
Family Tropomyosin 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000021795   Gene: ENSOANG00000031743   Transcript: ENSOANT00000021798
Sequence length 235
Comment pep:novel supercontig:OANA5:Contig2778:40861:47726:-1 gene:ENSOANG00000031743 transcript:ENSOANT00000021798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEILRLKVKVQEKQAAVLTLKQQKKGAQKAVVKMEQELRELEEQLCTEQAQQRQRAEQL
EKKFQEEKRDSEGPAGRPGEDNLTEQLAQALKEHQVLMEELSRSKSDFEAIIQAKNKELE
QTKEEKEMVQAQKEEALNHFSDVLENELQCTICSDYFIEAVTLNCAHSFCSFCISEWMKR
KEECPICRQLIQSKSRSLVLDNTIGRMVESLSAEVKERWAAHVKERREKITPAEN
Download sequence
Identical sequences F7DBM1
ENSOANP00000021795 ENSOANP00000021795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]