SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000024509 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000024509
Domain Number 1 Region: 4-99,130-236
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.13e-64
Family Calponin-homology domain, CH-domain 0.0000815
Further Details:      
 
Domain Number 2 Region: 8010-8165
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-20
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 3 Region: 7791-7915
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-20
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 3076-3232
Classification Level Classification E-value
Superfamily Spectrin repeat 4.65e-19
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 5 Region: 1582-1717
Classification Level Classification E-value
Superfamily Spectrin repeat 7.72e-19
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 6 Region: 7052-7185
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-17
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 7 Region: 5005-5163
Classification Level Classification E-value
Superfamily Spectrin repeat 2.76e-17
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 8 Region: 7366-7514
Classification Level Classification E-value
Superfamily Spectrin repeat 1.33e-16
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 9 Region: 3230-3350
Classification Level Classification E-value
Superfamily Spectrin repeat 3.84e-16
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 10 Region: 2418-2552
Classification Level Classification E-value
Superfamily Spectrin repeat 6.2e-16
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 11 Region: 4466-4623
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000144
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 12 Region: 6929-7051
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000497
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 13 Region: 6718-6858
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000408
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 14 Region: 2636-2773
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000432
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 15 Region: 3878-3994
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000533
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 16 Region: 1365-1497
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000106
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 17 Region: 7919-8028
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000173
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 18 Region: 3767-3883
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000249
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 19 Region: 4249-4404
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000763
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 20 Region: 519-657
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000096
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 21 Region: 7581-7724
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000418
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 22 Region: 3526-3658
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000432
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 23 Region: 5884-6024
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000182
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 24 Region: 5672-5776
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000314
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 25 Region: 7257-7376
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000379
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 26 Region: 2312-2431
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000016
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 27 Region: 2786-2903
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000162
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 28 Region: 2206-2361
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000639
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 29 Region: 2009-2148
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000131
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 30 Region: 3339-3453
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000016
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 31 Region: 1670-1823
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000165
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 32 Region: 1886-2033
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000132
Family Spectrin repeat 0.0076
Further Details:      
 
Domain Number 33 Region: 5134-5236
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000158
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 34 Region: 5479-5595
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000168
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 35 Region: 2988-3088
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000176
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 36 Region: 841-974
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000277
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 37 Region: 4917-5015
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000187
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 38 Region: 1507-1615
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000619
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 39 Region: 3959-4093
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000971
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 40 Region: 1046-1185
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000983
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 41 Region: 3419-3521
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000157
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 42 Region: 6336-6441
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000183
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 43 Region: 4788-4901
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000072
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 44 Region: 6034-6147
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000749
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 45 Region: 6642-6755
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000918
Family Spectrin repeat 0.003
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000024509
Domain Number - Region: 6512-6596
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000131
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 5247-5339
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000302
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number - Region: 4166-4293
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000411
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number - Region: 1250-1362
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00372
Family Spectrin repeat 0.022
Further Details:      
 
Domain Number - Region: 4646-4739
Classification Level Classification E-value
Superfamily Spectrin repeat 0.016
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 2555-2625
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0187
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 5585-5649
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0648
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000024509   Gene: ENSOANG00000015557   Transcript: ENSOANT00000024513
Sequence length 8373
Comment pep:novel chromosome:OANA5:3:40374318:40801795:1 gene:ENSOANG00000015557 transcript:ENSOANT00000024513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNPPMMVDDLFEDMKDGIKLLALLEVLSGQKLPYEQGRHMKRIHSVANIGTALKFLEGRR
IKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSTSSVDSLVSSET
SSPPNKRKVGTKIQGNAKKALLKWVQHTAAKQAGIEVKDFGRSWRSGVAFHSVIHAIRPE
LVDLEKVKRRSNRENLEEAFTIAEVELGIPRLLDAEDVDVDKPDEKSVMTYVAQFLKHYP
DPHNTAMDGQENDDPLQAIPTFAISIPKLKREDRLMLRDLKVWVEQFERDLTRAQVVETS
FRDRYQAFKHFRVQYEVKRKQIELAIQPLRKDGKLSLDQAMVKQAWDRVTSRLFDWHIQL
DKSLPVPLGTIGTWLYRTEIALREDIVIQQVHEETANTIHRKLEQHKDLLKHVDGHKKVF
QEIYRTRSVNGVPIPPEQLEDMAERFNIVSSTSELHLKKMEFLELKYRLLSLLVLAESKL
KSWIIKYGRRESVELLLQNYISFIENSKFFEQYEVTYQILKRAADMYVKADGSVEEAENV
MKFMNETTAQWRNLSVEVRSVRSMLEEVISNWDRYSSIVASLQAWLEDAEKMLNQSEYAR
KDFFRNLPHWIQQHTAMNDAGNFLIETCDETVSRDLKQQLLLLNGRWRELFMEVKQYARA
DEVERMKKEYLDHVTTLSIYTAGAIGKLSEFLEISSLNVRIFIQDLEDIKQRVPVMEAQY
KKITKTAQIITKESPQEEVNEMLATLSGIKDQLNKVKEYYPPLLYESQQLLIPLEDLEKQ
ITSFYESLEKINEIISLLDHEAQSTVIFKQKYQELSTCQEKCKVTLTLIEEGSQTIQRFV
ALSKVIKHFDQTALQRKVAEVHVAFQNMTKKTTDWRKNVETNSRLMNKFEESRSELEKVL
HNAQSCINEKGNPEALLKKHTEFFSQLDQRVLNAFLKACDELTDILPEQEQQSLQEAVRK
LHKQWKDLQAEAPYHLLHLKVEVETNRFQATVEECRAELARETKLLLQESSERIIKEHRV
FFSENGPQHLCEKRLQLIEELCLKLPERDPGRTAPESCRKTLRNLKAQIDKTSAKLMEHP
DKWKDYKIRFLDLSSWISSKEQQLKQIKREAKDTTKYGDIKPAAEGIRDEVSKQGECLSW
LKSRLKFLTEVSTAMEAEKQADELSKVSSDFKKLVTLLAEVEKMLSSLGDCVQYKEIVKY
SLEELISSSKKVQEQAEAILDSENLFEAQQLLLHHQQKTKMIQAKKKDVQQQLARAQGEG
EMPRRVQEELKKLEGTMDHMEQTTERQERRLQVTIRKWERFEANKETVVRYLFQTGSHHE
RFLSFSSLESLSSELDQTKEFSKRTEAVAVQAQNLVKEASEIQLGCKNKEVLQQQATSIQ
EQVKKLEDTLEEDIKTMEMVKKKWENFGNNFESLSVWITEKEKELDGLETSSSPLDMQIS
QIKGIIKDINDRTSGIPDLEEATQSFAQYITTGESARIKAKLTQIRRYWEELREHGQCLE
GMILGNASQQQKFDESLTKIQQCLSEFDAKLEEPVIICSSATETYKVLQEHMDLCQALAS
MNNTITSFSASARKVINKDTAFQEATNLQQRYERTIGKAKERQTMLENLLLHWQRLEKEL
STFLTWLERCEASASSPEKDISADRVKLEGELQLVQTLQDEVVGHASLYSSLLQMKESLF
SVASKDDVKVIKLQMEQLEERWRVLPQIISKRISFLQSVVAEHQQFDELLLHFSVWIKQF
LAELHSSSEINIVDHQATLVRCKDHSVEVEGKKQEMLCLKGHLGKLCSFSRGEDHHILQS
KTEDCFQLFQEACQITERRQLALTQIGNFLQLHASLSGVLQRLRQTVEATSSMDKAQSDL
LKKDLNAAIQDTKKLESTAIGLDGVLSKAQYHLKSSTSEQRTSCRATADQLSLQLEAIQN
LLGTKQGEAEALGLLKKAFMDHKEELLKCIEDIEERTDKERLKEPTRQALQQRLRAFNQL
EDELNSHEHELSWLKDKAKQIAQKDISLAPEIDREINRLEVTWDDTKTLIHENQGQCCGL
IDLMREYQSLKSAVSKVLENASNVTVIRPTVKDQEDIRWTISKHEMAKNEMNEKQKDLND
FTSKGKRLLSELKRIHSSDVLLVKTDMDSTVDKWLDVSEKIEENVDRLSVSLSIWEDVLT
ARDEIDGWTNNSIPQLNESISNLNSSIKTETFLKEFESEVKNKGLKLEELHSKVLDLKEL
TKNPETPADLQFIEADLRQKLEHAKEMSEIAKGTLKDFSAQTTQLEKCIHDTTAWLTKME
DTLLCCAQTPNCESLKKMREIQKELQIQQSSIDSAQETLNGLCRKYHSVELESLGATMTE
LVKKFETVSQLGSKTQASLQDTLDRRFNASMQEFQEWFSGIKAAVRESSDRSGDSKAIEA
KLHDLQRILDSINEGQNKLDTVTQEGQNLFAYLPKQIVSTIQEQITTANEEFQAFLKQCL
KDKQALQDCASELGSFEDQHKKLSLWIHEMEERLSTESLGENKQHIPEKKNEFHKVEMFL
GELLAARESLDKLSQRGQILNEEGHGAGKEVRLAAQLLTGYQNLVKITKEKLRSCQIALQ
EHQALEAALQSMWSWIKDIQEKLASAESMVGSKATLEKRLFQIQEIILMKGEGDVKLNMA
IGKGEQALRSSNREGQKVIQAQLQTLRDVWANITSSSTHAQSCLESVISQWNDHLERKSQ
LEQWMESIDRRVAEPIQRKASLKEKFSQLDYCQAIVSEAEEHTGALHRLTEKSKELYEKT
EDDSFKEAIQEELKTQFNDITTIAKEKMRKVEEIVKDHLMYLDAVHEYTDWLHSAKEELQ
RWSDVSGDSCATQRKLSKIKELIDSRQIGASRLNRVESLAPTVKQNTTASGCELLDTEMQ
ALQSDWKHWEDSVFQTQSCLEELVSQMALSEQEFSAQVAQLEKALQDFSALLETWSQQLT
LLEGKNTDNEIVECWHQEKDILEALRKAEPMTDELKAHLNDLCRFSRDLSPYSTKVSGLI
KEYNSLCLQASKRCQNKEQTLQQRFRKALRDFQQWVINAKITTAKCFDLPQSINEASASL
QKIQEFLSESENGQHKLNMVVSKGEMLNGLLSEEKAKDVQTKVDRAKEDWKNFHSHLHQK
ESTLENLKIQMKDFEVTAEPLQDWLNKTEKMVRDSSSRLHDLPGKRREQQKLQSVLEEIN
CHEPQLHRLKEKAQQLWEGQAASKSFMHRVSQLSSQYLALSNLTKEKVSRLDRVVAEHTQ
FSVGIKELQDWMADAIHMLESYCHPTSDKSVLDSRMLKLEALLSVKQEKEIQMRMVLTRG
ELVLQNTSPEGVPTIQGQLQAVKDMWAALLTTGIRCKSQLEGALSKWTSYQDDVRQFSNW
MDSVEASITACERQCAELRDKTTALGKVKLLSEEVLSHDNLLETIEMKGVGMTEHYVTQL
ELQDLQERYSAIKDRTKEAVTKSERIVRLHQEYQNDLKVFEVWLQQEQEKLDRFSLLEGD
AQTHDTALRELQELQVRCAEGQALLNTVLHTREEVLPWGIPQVEDRILESVRQDWHTYQQ
RLSEIRTQFNSTVNKLRVMEQKFQQVDEWLKTMEDKGSIRAGRQSNRATKEMQLQQMKKW
HEEITSYKDEVEEVGTRAQELLEESHVSSRMGCQATQLTSRYQTLILHVLEQIKFLEEEI
QSLEESEQAFTSYVEWYGSTHKNFKNVSSEIDKVDKIMMGKKMKTLELLLSDMEKGHSLL
KSAREKGERAVKYLEDGEREKLKSELHVHMEQLEELASTVRREHTILEKCLHLAKEFSDK
YKVQTQWLAEYQAILQTPEEPKTELYEKKAQLSKYKSIQQMVLSHEPSVKSVNEKGEALL
EMVHDATLRDKIQKLQTDYQELCNAGKEHVSSLELKVKEHEDYNSELQEVEKWLLQMSGR
LVTPDLMEISSLETITQQLANHKAMMEDIAGFEDRLDSLKNKGDCLINQCADHLQAKLKQ
NVQAHLQGIKDSYSAICSTAQRVYQSLEHELQKHVSRQDTLQQCQAWLSAVQPDIKPNPQ
PPFCRADAAKQVKQFRALQEQARTYLDLLCSMCDLSNPEVKTTAKSIQQTKQMIEQEINR
SQNLNQGWEEIKQMKTELWIYFQDADQQLQNMKRRQAELELNIAQNIVSQVKEFVQKLQS
KQTSVTAVTEKVNKLTQGQESPEHSEIGHLRNQWMDLCLQTNSLLLQREEDLQRTRDYHD
CLNVVEVFLEKFTKEWDNLARSDADSTTVHLEALKKLAEALEEKRYAIGDLKDQKQKMMD
HLNLDDKELVKEQTRHFEQRWFQLEDLIKKKIQVSVTTLEELNLVQSRFQDLMEWAEEQQ
PSISEALQHSPPPDLAQNLLMDHLAICSELETKQMHLKSLIKDADRVMADLGLNERQLIQ
KVLSDAQSHMHSLTNLVDQKRKFLNKAVSEKTQFLIAVFQATSQIQQHERKITFHEHICL
LPDDVGKQVKTCKSTQASLKTYQNEITGLWAQGRELMKEATEQEKYEVLSKLQELQSVYD
TVLQKCSQRLQELEKNMVSRKYFKEDFDKMCHWLKQADIVTFPEINLMNGNNGLYSQLAK
YQQILEQSPEYENLLLTLQRSGQEILPTLNEVDHPYLEEKLSSLPQQFSVVVALAKDKFY
KVQEAILARKEYASLIVLTIQALSELEDQFLTMDKAPKSLLAEEAFTLQEGCKALLGEAL
SLGAAVDELNQKKEGFRSTGQPWEPEEMLQLVTLYHKLKRQVEQRLSLLEDTTTACQKYE
DLCQQLKKQLESVRKEQIQVNEETLPVEEKLKAYHALAGSLQDSGILLKQVNEHLEDLSP
HLDPEVYEAASHQVQLWQEELKSLTATIGETVMECENRLVQSIDFQTEICRSLDWLRRVK
AELSGTLSLDLKLQNIQEEIRKVQIHQEEVQSSLRIMNALSSKEKEKFMKAKELISADLE
NTLAELSELDAEVQEAIRIRQATLTETYSLCQKYYQVIQAGSDWLEDAQELLQLAGNGLD
VESSEENLKNHVEFFNTKPQFHGFLEELQDLMSKLEPFIKSSGKEELKKNVACLEQKGKG
IKRESQAQLELLQSCATQWQDYQKAREEVIELMNEAEKKLSEFSVSRASSSQEAEEKLLE
HKSLVSVVNSFQERITALEERASQLEQIGNDASKATISRSMTTVWQRWNRLCSVTRDQEN
ILKDARDEWQAFNSKVQKATERIDQLQDNLPGSSAEKASKAELSVLLDHHDTFVLEVEQQ
QSALGLLKQQAVNMLRDVEMEPAAGKKPPVMQEITAMQDRCHNIQEKVKKSGKLVKQELK
EREVVEAEINSVKSWIQEAKEYLMNPTMEIDAQLDELQALLTEAGTHRQAIEKIAEEQQN
KYLGLFAILPSELSLQLAEVALDLGATNDQIQAKVKEGQQSKAMNQEFSQKIQGVTKELT
TILTKLKTKTNNLAQAKIDQKILGEELDACNVKLIELDVAVRDFTEQNSQLAKKLSKKIG
KLTELHQQTIRQAEYRLSKLNQAAAHLEEYNEMLEFILKWIEKAKVLIHGNITWNSASQL
RDQFISHQSMLEESGEIHSDLEAMNEKLEYLASVYCTEEMSQQLSELGRETEELRQVIRL
RMQNLQDAAKDMKKFEIELKTLQNALEQAQMTLTSPEFGRLSLKEQLSHRQHLLSEMESL
KPKVQAVQICQVALRIPEEMVTSLPICHTALRLQEEASRLQHTAIQQCNIMQEAVVQYEQ
YEQEMKHLQQLIEEAHREIQDKPVATSNIQELQAQISRHEELAQKIKGYQEQIASLNSKC
KMLTMKAKHATMLLTVTEVEGMEDLDTELLSTHSAHPSVVMMTAGRCHTLLSPVTEESGE
EGTNSEISSPPACRSPSPVANTDASVNQDIAYYQALSAEQLQTDAAKIQPSTSSTQESYE
PGLESTASAKLDDLQRSWETLKNVISEKQRTLYEALERQQKYQDSLQSISSKMEAVEVKL
NESLEPGKSPESQMAEHQALMDEILMLQDEINELQTSLAEELVSESLEMDAADQLALQST
LTVLAERMSTIKMKASGKRQLLEEKLNEQLEEQRQEQALQRYRCEADELDHWLLNTKATL
DTSLVTSEEPMDMEDQLVDCQNMLVEIEQKVVALSELSVHNENLLMEGKAHTKDEAEHLA
VKLRTLKGSLLELQRALYDKQINIQGTSQEKEECEAELAAAQSPSVQEWLAQARTTRSQQ
QQSSLQRQKELEQELAEQKNLLRSVASRGEEILTQHTSIDGSSLSSSEKPDVLSQELGSE
SEKTSTEDQMRMKWESLHQEFSTKEKLLKDALEQEQDQLLYSRPNRLLAGVPLYKGEGQA
QDKSSVASLLDGLNQAFEEVSSQNGGAEGQNVHLEQKLYDGVSATSTWLDDVEEHLFVAT
ALLPEETETCLYNQETLAKDIKEMSEEMDKNKNLFSQAFPEQGENRDVIEDTLGCLLGRL
SLLDSVVNQRCHQMKERLQQILNFQNDLKVLFTSLADNKYIILQKLADVAEQPAAEQIEA
MQQAEDGLKELDAVIVELKRRGDKLQVDQPSTQELSKLQDMYDELMMTIGSRRSGLNQNL
ARKKQYERLLQDLADLSETGQEKMAGGQKMIVSSKEEVQQALDKHKEYFQGLESHMILTE
TLYRKIISFALPKETQFHSELMDQASVVLKRAHKRGVELEYILETWSHLDDDYQELIRQL
EAVESSIPSVGLVEETEERLTDRIALYMRLKSSLTEYQPKLYQVLDDGKRLLISISCSDL
ESQLNKLGEHWLNNTNKVSKELHRLETILKHWTRYQSESAELTRWLQSAMDRLEFWSQQS
VTFPQELETVRDHLNAFLEFSKEVDAKSSQKSAVLSTGNQLLRLKKVDTAALRSGLSQID
SQWMELLTHIPVVQEKLHQLQMDKLPSRHAIAEVMSWISLMESVIQQDEENITNIVGYKA
IHEYLQKYKGFKIDINCKQLTVDFVNQSVLQISSQDVESKRSDKTDFAEQLGTMNRRWQI
LQGLVTEKIQLLEGLLESWTEYDNNVKCLKIWFETQEKRLKEHHRIGDQASVQNTLKDCQ
ELEELIKAKEKEIEKVEQNGLSLVQNKKEGASAIVINTLGELNHCWANLDHQVAQLKIFL
QSMLDQWGIYKVAYDELNSYLMEARYSLSRFRLLTGSMEAVKVQVENLQGLQDELENQEN
SLQKFGSVTNQLLKECHPPVTETLTNILKEVNMRWSNLLEEITEQLHSSKALFQLWQRYK
DYYKQCASTILQHEDRSNELLKTATNKDIADDEVAIWIQNCNELLKSQKTVQDSLFVLQE
LGDQLKQQVDSSAASAIQSDRLSLSQRLSALEQALSRQQTMLQKTGVLDYETFSKSLDGL
EAWIVEAEEVLTEQDPSHASDLSAIQDRMEELKGQMLKFSSMVPDLDRLNELGYRLPLSD
KEIKRMQNLNRHWSLISSNTTERFSKLQSFLLQHQTFLEKCETWMEFLIQTEQKLAVEIS
GNFQHLLEQQRAHELFQAEMFSRQQILHSIIIDGQRLLEQGQVDDRDEFNLKLTLLSNQW
QGVIRRAQQRRGIIDSQIRQWQRYREMAEKLRKWLVEVSYQPVTGLGSVPIPLQQARTLL
DEIQLKEKVLLRQQGSYILTVEAGKQLLLSADSGAEEALQAELTEIQDRWKSASTRLDQQ
KKKLSFLLKDWEKCEKGIADSLEKLRAFKKKLSQPLPDHHDELHIEQMRCKELENAVGGW
TEDLTHLALLKETLSTYISPDDISILSERIELLHRQWEELCHQVSLRRQQVSERLNEWAV
FSEKNKELCEWLTQMESKVSQNGDILIEEMIEKLRKDYQEEIAVAQENKIQLQQMGERLA
RASHESKASEIEYKLGKVNDRWQHLLDLIAARVKKLKETLVAVQQLDKNMSILRSWLSHI
ESELSKPVYETCDSEEIQRKLNEQQELQRDIEKHSTGVASVLNLCEVLLHDCDACATETE
CDSIQQATRNLDRRWRNICAMSMERRLKIEETWRLWQKFLDDYSRFEDWLKTAESTAAFP
SSSGVLYTVAKEELKKFEGFQRQVHESLTQLELINKQYRRLARENRTDSSCRLKQMVHEG
NQRWDNLQRRVTSILRRLKHFIGQREEFETARDSILVWLTEMDLQLTNIEHFSECDVQAK
IKQLKAFQQEISLNQNKIDQIIVQGEQLIEKSEPMDAAIIEEELDELWRYCQEVFGRVER
YHKKLIRLPLTDDEPDLSDREMDMDESADLSDLHWPDKSTDNVLSPHPSSNLSLSLAQPL
RSERSGRDTPASVDSIPLEWDHDYDLSRDLESAVSRNLHSEDEEGQDDKEFYIKGAAGLA
GEPSSLETHIRQLDKALDASRLQMQQTENIIRSKTPTGPELDSSYKGYLKLLGECSGSID
AVKRLGFKLKEEEEKFSGFINLDSTETQTAGKL
Download sequence
Identical sequences F7E814
ENSOANP00000024509 ENSOANP00000024509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]