SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000025649 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000025649
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.15e-51
Family Calponin-homology domain, CH-domain 0.00000173
Further Details:      
 
Domain Number 2 Region: 205-314
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-21
Family Spectrin repeat 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000025649
Domain Number - Region: 322-360
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0158
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000025649   Gene: ENSOANG00000020191   Transcript: ENSOANT00000029453
Sequence length 360
Comment pep:novel chromosome:OANA5:2:17006661:17018012:-1 gene:ENSOANG00000020191 transcript:ENSOANT00000029453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVELVNIGGTDIVDGNHKLTLGLLWSIILHWQVKDVMKDIMSDLQQTNSEKILLSWVRQS
TRLYAQVNVLNFTTSWSDGLAFNAVIHRHKPDLFSWDRVTKMSPIERLEHAFTKAQNHLG
IEKLLDPEDVAVQLPDKKSIIMYLTSLFEVLPQQITMEDIREVETLPRRYKKECEEGEFH
VQNTAPEEHEGLRAETPSMVTEVDMDLDSYQEALEEVLTWLLSAEDTFQEQDDISKDVEQ
VKDQFATHEAFMMKLTAHQSSVGSVLQAGNQLIAQGNLSEEEEYEIQEQMTLLNSRWEAL
RVDSMDRQSRLHDVLMELQKKQLQQLSDWLTVTEERIQKMETFPLDDDLQSLQKQLKEHK
Download sequence
Identical sequences F7CC45
ENSOANP00000025649 9258.ENSOANP00000025649 ENSOANP00000025649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]