SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000026330 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000026330
Domain Number 1 Region: 946-1060
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-20
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 2 Region: 836-949
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-18
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 3 Region: 1025-1162
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-17
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 4 Region: 486-585
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-16
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 5 Region: 398-510
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-16
Family Spectrin repeat 0.0081
Further Details:      
 
Domain Number 6 Region: 587-693
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000366
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 7 Region: 709-813
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000222
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 8 Region: 273-316,345-409
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000348
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 9 Region: 1117-1300
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000103
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 10 Region: 3-83
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000131
Family Spectrin repeat 0.014
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000026330
Domain Number - Region: 146-268
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0036
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000026330   Gene: ENSOANG00000020698   Transcript: ENSOANT00000030132
Sequence length 1320
Comment pep:novel supercontig:OANA5:Contig15978:556:16154:1 gene:ENSOANG00000020698 transcript:ENSOANT00000030132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPELTALRARAEEVRQASAAGVLRREHALSLLAQFAEARDELEPWLEQAQGPISQLDPNG
VDSPEACKEQQELLQSLREPIAEQPAPWVGEACTKWARPTPPDSTLGSTLPRSPLYPGLA
SSSLDRNPPTASALGQAAFMFVYLCERLSRLAEQLEQLSHRVQAAGTVRAEAGRIREQLR
EQVRLLGDLEPVGAALEAAQARAQELGAGTASSKPGAAAQGRGAGEGGQARLGLRSGLSA
LQAQVEQLRGRWLEVRAEAREQEQRLRGLLVLAEQFWQGLAELAGSLGGTQHLVLHLEEA
GPEPEGLRSRLSAMQVPGPCSSPGPARGEEAQGPSQPMPSCTQALREEVDALQTDLDALG
ALGLELLSACGDVDRPEVTRSLDELYASWHNLSRVWTERNGRLEEQLQEALGYQETMQRL
LDWLEGAELRMGEEFLVGGDLEMVKQQLDELKGFKQELYQSRVEVESLRHRPAPGDPEKP
SPPPLLGDFRQRWDHLEEEAVSRQHQLEAALLGLGQLQPQLDELVQWLEHTADQLQGAPS
LGLDLQSCEIELAKHRVLRNDVLSRARTVQSVSEAARGLLATGLGEAEAGLQLALQTLQR
RWESVRSETESRQLQLENNLGQLQDVELEASELLEWLEQVDVRLFLFKPSWGPPDTPQER
LALHMELCRELEQKRAAYEGLRERLQRLVPAGPRPLPRPVGTEHSLWLLEHTWQRVATRA
GERKVWLSEGLALSTEFHQRAQELVRWGVQAEERLGALPPPSLVLDTVSAQLQEHKALAQ
EVASQGEKLAGLESVAGRLKGFSQEQDCTMIQSLVFTAQEWLGRARQRVGERGTALEEAR
RRAKQFTESRRLLLDWLDEVEPTLELPRDSALNQGEIKVQLSQHKEFQRELRGKRPVFEA
TLRGGRALREGALLPEDAGPLDLLLAELRGRWDGVCSRALERQQALEEVLLFSGRFADAL
PALMDWLYQAEPQLAEEGPVAGDRDLVNRLVDKHKVFQKELGRRAGCVRLLRRSVRELTG
GGGGGADSQWLQRQVEELGQRWELVCRLSLARQARLEGALQQAEEFDGLVHSFLERLTDV
EKTLRLGPLPEEEGAVRDCQNRLQELLRNLQCQQLELECVTSLGEEILNDCHPDAVITVR
SWVSVVTSRFQEVLSWAQKQGQRAQERLEVLEAQRAELTRLLDWITAAEEALTLRDLEPL
PEDMEQLERLRAQHTGWEVEEETAKESEEERVEKKENPSPQCLSPSIFLGLSRRRGAGKT
GSAPRMPLLDLEPQSPLAAQLLGRWQQLWLIALDRQYRLQAAAQRLEEVRDGGWGEGVWR
Download sequence
Identical sequences F7EL86
ENSOANP00000026330 9258.ENSOANP00000026330 ENSOANP00000026330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]