SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000026908 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOANP00000026908
Domain Number - Region: 50-112
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0171
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 5-61
Classification Level Classification E-value
Superfamily CYTH-like phosphatases 0.0719
Family CYTH domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000026908   Gene: ENSOANG00000021138   Transcript: ENSOANT00000030708
Sequence length 128
Comment pep:novel supercontig:OANA5:Contig6813:3161:20732:-1 gene:ENSOANG00000021138 transcript:ENSOANT00000030708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDYENQITDLKKENFNLKLRIYFLEERMQQKFDGPTEDIYKINIELKVELESLKRELQK
REHLLIKASKAVESLTESGGSEIQCVKEEARKKLQQVEDLLTGRIRLLEEASVKTSQSNQ
ASLMPAVV
Download sequence
Identical sequences F7F715
ENSOANP00000026908 ENSOANP00000026908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]