SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000027939 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000027939
Domain Number 1 Region: 440-531
Classification Level Classification E-value
Superfamily Immunoglobulin 1.86e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 536-626
Classification Level Classification E-value
Superfamily Immunoglobulin 3.53e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 18-181
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000216
Family Spectrin repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000027939   Gene: ENSOANG00000021914   Transcript: ENSOANT00000031737
Sequence length 641
Comment pep:novel ultracontig:OANA5:Ultra514:16465933:16494486:-1 gene:ENSOANG00000021914 transcript:ENSOANT00000031737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLKNQIQQVDMHAEKMQALKKKMENITSKISNSLIRCSKVCILLESINELQRQVGEFG
RGVEDYKKNLDMTEQLQEMVEECQFWYDEASATVVRVGKYSVECKTQEAVEILYKQFSKF
ITPTVPQQEERIQEITDLAQRLYGIEDGQKYVEKIKAKHKEVLESVTELCRSLMELGEKL
KEPKKVADIPGVGEGLLSLDVDLSSSVQEESIHTLLLSEETPSGEEYECISPDDVSLPPL
PVSPESNPMQGGGEIEGSPSSNPHSLHVRSSSLQMQINAGSQRASDEPHLSIPAASADLS
DGGRETVSTQFERSPRLAAEHFPKFKAGCRFTSLELLETSSASGTIKAKPSASMMSEVHE
TYMQRYHQVHTSMSKTQERLHDNNNFTKTQDRLHASPGAFPGLGFRADTTRSHQSQMVSP
EEIKSASEKNSLVSLSGRAPNFSKTLSNATVVEGSPVTLEVEVTGFPEPTLTWYKKGQKL
SSDGHLKVLQKETKHTVFIREVCETDAGLYVARAQNSSGTLSSSAILRVTVQRKLPGFLE
RFGPANLQEGDDLLLHCTVSGRPRPKVIWSKDGVRVIAGDFNIQKLGDAYYLFKRNVVLA
DTGEYVCSASNEVGEAFCSANIVVTGEKRTTYRELMISFTS
Download sequence
Identical sequences F6UGF8
ENSOANP00000027939 ENSOANP00000027939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]