SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000029054 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000029054
Domain Number 1 Region: 22-93
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000485
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000029054   Gene: ENSOANG00000022738   Transcript: ENSOANT00000032850
Sequence length 108
Comment pep:novel supercontig:OANA5:Contig16611:929:2264:-1 gene:ENSOANG00000022738 transcript:ENSOANT00000032850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLKRLLEEWRPRVERLLQDSGTLPSLQGKWELLVQLAEARQGLLERIVPAAQSFQADQEG
FLAWLVPTERLLAKLWWEDRGAGRLQEALKQVQVWGRVLGRDEGRGEM
Download sequence
Identical sequences F6X4V1
ENSOANP00000029054 ENSOANP00000029054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]