SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000029454 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000029454
Domain Number 1 Region: 309-411
Classification Level Classification E-value
Superfamily Spectrin repeat 9.81e-17
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 2 Region: 216-307
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000432
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 3 Region: 390-489
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000169
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000029454   Gene: ENSOANG00000028846   Transcript: ENSOANT00000038698
Sequence length 620
Comment pep:novel supercontig:OANA5:Contig12868:638:9598:-1 gene:ENSOANG00000028846 transcript:ENSOANT00000038698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQQIANRVQRDSVCCEDKLTLARKALQSDSKRLDSGLQFQNEAEIAGYILECENLLRQQ
VIDVQILLDGKYYQADHLVQRVAKLRDEIMALRTECSSVYSKGRTLTTEQTKLMISGITQ
SLNSGFAQNLNPCLNSGLTQSLTPSLTPSNLTSGLTTRLTSSVTPVYTPGLIQSYSSGVD
TNALQTLKLMQIRKPLLKSSLVDQNLTEEEVNMKFVQDLLNWVDEMQVQLDRCEWGSDLP
SVESHLENHKNVHRAIEEFESSLKEAKISEIQMTAPLKLTYAEKLHKLESQYAKLLNTSR
NQERHLDTLHNFVSRATSELIWLNEKEEEEVAYDWSERNSNISRKKEYHAELMRELDQKE
DIIKSVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCHCVEQHIKENSAYFEFFS
DAKEATDYLKNLKDAIYRKYSCDRNSSIHKLEDLVQESMEEKEQLLQYKSTVASLVGRAK
AIIQLKPRNPENPLKASIPIKAICDYRQIEITIYKDDECVLASNSHRAKWKVISPTGNEA
MVPSVCFTVPPPNKEAIETANRIEQQFQNVLALWHESHINMKSVVSWHYLTHEIDAIRAG
NVASVGETLLKCLLTPQETL
Download sequence
Identical sequences K7E7E7
ENSOANP00000029454 ENSOANP00000029454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]