SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000029619 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000029619
Domain Number 1 Region: 7-157
Classification Level Classification E-value
Superfamily Spectrin repeat 4.11e-24
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 2 Region: 163-223
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000389
Family Spectrin repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000029619   Gene: ENSOANG00000032030   Transcript: ENSOANT00000038863
Sequence length 238
Comment pep:novel supercontig:OANA5:Contig10469:6190:7631:1 gene:ENSOANG00000032030 transcript:ENSOANT00000038863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVEKELARVRAEADWLGRLHPPVQESLAGRLAEAEEAWGRLQRRARERGLRLEQAERGH
AHLSACRELLGWVQEMQARVAAAEPAGDVAGAERSLRQHEELGREMEEQQLRVRDAQQEG
ARLVDGGHFMAPEVEEWQQELGEQLQELQAAWAHRRELCRENLDLQELRQELEQAEAWLA
AREGLLLDPDCGHSVSDVEELLRRHQDFEKMLAAQEEKFAHLHXXXXXXXXXXXXXXX
Download sequence
Identical sequences K7E7W2
ENSOANP00000029619 ENSOANP00000029619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]