SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000030082 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOANP00000030082
Domain Number - Region: 25-75
Classification Level Classification E-value
Superfamily Spectrin repeat 0.048
Family Spectrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000030082   Gene: ENSOANG00000030051   Transcript: ENSOANT00000039326
Sequence length 80
Comment pep:novel supercontig:OANA5:Contig76325:496:1439:1 gene:ENSOANG00000030051 transcript:ENSOANT00000039326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELVNSSLRASSDSLENPRVTISELGDVIKNASGIYAEIDGAKAELQEKLGNLSNLNEDL
VQRAMEHAKDLQGHADELRR
Download sequence
Identical sequences K7E975
ENSOANP00000030082 ENSOANP00000030082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]