SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000032159 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000032159
Domain Number 1 Region: 9-90
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000051
Family Spectrin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000032159   Gene: ENSOANG00000030398   Transcript: ENSOANT00000041408
Sequence length 116
Comment pep:novel supercontig:OANA5:Contig53563:2362:3906:-1 gene:ENSOANG00000030398 transcript:ENSOANT00000041408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNASLANASSLSEAEQLQREHEQFQLAIESLFHATSLQKTHQSALQVQQKAEALLQAGH
YDSEAIRQCANKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVGQRTTGPGDDWR
Download sequence
Identical sequences K7EF52
ENSOANP00000032159 ENSOANP00000032159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]