SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000032246 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000032246
Domain Number 1 Region: 3-98
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-22
Family Spectrin repeat 0.00063
Further Details:      
 
Domain Number 2 Region: 201-317
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-21
Family Spectrin repeat 0.00052
Further Details:      
 
Domain Number 3 Region: 377-504
Classification Level Classification E-value
Superfamily Spectrin repeat 4.53e-19
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 4 Region: 97-203
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-18
Family Spectrin repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000032246   Gene: ENSOANG00000031810   Transcript: ENSOANT00000041494
Sequence length 519
Comment pep:novel supercontig:OANA5:Contig27170:4273:8844:-1 gene:ENSOANG00000031810 transcript:ENSOANT00000041494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRESWLSENQRLVSQDNFGYDLPAVEAAMKKHEAIEADISSYEERIQAVVELAQALAGEG
YYDARRIGAQRDSVLRQWGLLTGLVVARRGRLEQNLALQKVFQEMVYMIDWMEEMQSQLV
SRESGKHLLEVEDLLQKHGLLEGDIAAQAERVETLNAAALRFSQLQGYQPCDPQIICNRV
NHVQHCLAELRELAGRRREDLEASRQLWTFFRELEEAESWAREKERVLTAAQPGARDLSA
VVRRLGQHKILLGELGGRRALLQQTLRQGEQILARRAPGAEDITDRAAGARVRWQRLEDL
VGRRGRRLQDALDLHQFGAELEDLVAWLQDAYRLASSGDFGHDEHSSRWLARQHRALSEE
VEQHRGTVLGLRRQLAGLAPGPREGVEVQVRVVEVEQLYGEVAEVAALRRQWLSDALAVY
RMFGEVHACEVWIGEKEQWLQRMRLPDKLDDVEVVQHRFESLDQEMNSLMGRVLEVNHIV
QQLVDGDHPSAAEVRSCQDHLNSRSGRKGASCPFPWPTQ
Download sequence
Identical sequences K7EFD9
ENSOANP00000032246 ENSOANP00000032246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]