SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000032760 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000032760
Domain Number 1 Region: 41-108
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000161
Family GAF domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000032760   Gene: ENSOANG00000029733   Transcript: ENSOANT00000042008
Sequence length 110
Comment pep:novel supercontig:OANA5:Contig47489:3416:4646:1 gene:ENSOANG00000029733 transcript:ENSOANT00000042008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIQGDMEFWNSGPGPFPELSLFLGGAGPDAYIPSKPHLALLQLTFGRLGDVVEKKKSIT
LKDISSEELRQLQSMLGCEVLSMLCVPVISRATSQVVALACVFNKEGGEM
Download sequence
Identical sequences K7EGV3
ENSOANP00000032760 ENSOANP00000032760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]