SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000033165 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000033165
Domain Number 1 Region: 3-134
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-30
Family Spectrin repeat 0.00021
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000033165
Domain Number - Region: 138-167
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000489
Family Spectrin repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000033165   Gene: ENSOANG00000029342   Transcript: ENSOANT00000042411
Sequence length 167
Comment pep:novel supercontig:OANA5:Contig8248:1101:4063:1 gene:ENSOANG00000029342 transcript:ENSOANT00000042411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQKQESLCLRYQALKEPLATRRQKLTDLLHLHQISRDMEDEEAWIQETEPSAASTYLGK
DLIAAQNLLNRHQVILGNIDSHEPRIQAITDRGKKMVDEGHFAADEVSSRVSVLNDNMES
LRSRAARRRQDLEDNVRLLQYLADLLEAEAWIRDKEPLVDSTNYGAD
Download sequence
Identical sequences K7EI08
ENSOANP00000033165 ENSOANP00000033165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]