SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000033183 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000033183
Domain Number 1 Region: 28-105
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000099
Family Spectrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000033183   Gene: ENSOANG00000030890   Transcript: ENSOANT00000042429
Sequence length 120
Comment pep:novel supercontig:OANA5:Contig63912:582:3211:-1 gene:ENSOANG00000030890 transcript:ENSOANT00000042429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGGGEGQGRRGTRGTQLGLVAPGRSQENKLRALQWMQQLHDQLELQSYLQDCHELDGWI
HEKMLMARDGAREDGHKLHKRWLRHQAFMAELAQNKEWLEKIEKVSGGRGRGAGGEIDKM
Download sequence
Identical sequences K7EI26
ENSOANP00000033183 ENSOANP00000033183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]