SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000033186 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000033186
Domain Number 1 Region: 8-106
Classification Level Classification E-value
Superfamily Spectrin repeat 2.07e-16
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000033186   Gene: ENSOANG00000028422   Transcript: ENSOANT00000042432
Sequence length 109
Comment pep:novel ultracontig:OANA5:Ultra546:1484132:1488683:-1 gene:ENSOANG00000028422 transcript:ENSOANT00000042432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEILKHKDIVDELVKSGDKIMNTCSEEEKRSMKKKLDDLLKNYETICQINSERNLQLERA
QSLVNQFWETYEELWPWLTETQRIISQLPAPALEYETLRQQQEDHRVSS
Download sequence
Identical sequences K7EI29
ENSOANP00000033186 ENSOANP00000033186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]