SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000001687 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000001687
Domain Number 1 Region: 250-353
Classification Level Classification E-value
Superfamily RING/U-box 9.96e-20
Family RING finger domain, C3HC4 0.0000378
Further Details:      
 
Domain Number 2 Region: 2-49
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000484
Family WWE domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000001687   Gene: ENSOANG00000001059   Transcript: ENSOANT00000001688
Sequence length 479
Comment pep:novel supercontig:OANA5:Contig6370:13857:24833:-1 gene:ENSOANG00000001059 transcript:ENSOANT00000001688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPWLDLSTLGFCYLIYFGSMSQVNRQTQRKRRLRRRMDLAYPLTIGSIPKSQSWPVGSSS
GQPCSCQQCLLVSSTRAASNAILASQRRKLFPATTVRQSDTFSAATTTTPAPWAGGPGKG
DQDRTPGGPPETTFSRSQSAPGGPDLPGPNDLNRPRPPRGTVVSAKTSSIPPGVPALPVK
NLNGTGPVHPALAGMTGILMCAAGLPVCLTRAPKPILHPPPVHKSDIKPVPGVSGVCRKT
KKKHLKKSKNPEDVVRRYIQKVKNPPDEDCTICMERLVTASGYESVLRHRGVRPELVGKL
GKCGHMYHFLCLVAMYNNGNKDGSLQCPTCKAIYGEKTGTQPPGKMEFHLIPHALPGFAD
SQTIRIVYDIPTGIQGPEHPNPGRKFTARGFPRHCYLPDNEEGRKVLRLLIMAWDRRLIF
TIGTSNTTGESDTVVWNEIHHKTEFGSNLTGHGYPDPNYLDNVLAELTAQGVSETPLKD
Download sequence
Identical sequences F6PHT4
ENSOANP00000001687 9258.ENSOANP00000001687 ENSOANP00000001687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]