SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000003132 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000003132
Domain Number 1 Region: 37-166,221-284
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.49e-49
Family Calponin-homology domain, CH-domain 0.0000883
Further Details:      
 
Domain Number 2 Region: 302-425
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-31
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 3 Region: 1271-1423
Classification Level Classification E-value
Superfamily Spectrin repeat 4.68e-30
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 4 Region: 1494-1634
Classification Level Classification E-value
Superfamily Spectrin repeat 3.64e-26
Family Spectrin repeat 0.0009
Further Details:      
 
Domain Number 5 Region: 1165-1318
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-24
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 2138-2273
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-23
Family Spectrin repeat 0.00096
Further Details:      
 
Domain Number 7 Region: 609-739
Classification Level Classification E-value
Superfamily Spectrin repeat 2.1e-23
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 8 Region: 1714-1849
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-21
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 9 Region: 703-815
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-19
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 10 Region: 1059-1194
Classification Level Classification E-value
Superfamily Spectrin repeat 2.47e-19
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 11 Region: 2227-2365
Classification Level Classification E-value
Superfamily Spectrin repeat 4.97e-19
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 12 Region: 865-1000
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-18
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 13 Region: 1907-2043
Classification Level Classification E-value
Superfamily Spectrin repeat 1.17e-17
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 14 Region: 2018-2135
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000209
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 15 Region: 544-643
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000024
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 16 Region: 427-538
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000017
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 17 Region: 1628-1743
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000216
Family Spectrin repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000003132   Gene: ENSOANG00000001973   Transcript: ENSOANT00000003133
Sequence length 2365
Comment pep:novel supercontig:OANA5:Contig2594:471:29756:-1 gene:ENSOANG00000001973 transcript:ENSOANT00000003133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STRKPGSRRAGGDGGNGKRRGVDRRAGCRSPGPAMDSEYEQGHIRKLQAQRMLMQEKTFT
NWINNIFSHGKANVTLGNVYLDLKDGTNLLRLLELISGETLPPPSRGRMRVHFLENNSRA
LTFLRSKVPVPLIGPENVVDGDQTLILGLIWIIILRFQISRISLDKVIISRHPHRYHCGA
RRALACQEGRGEARGVGPAGRRAGQGSGPLATRCPGPPPPAARRPDLIEYGPLRAERPLH
NLDYAFEVAQRHLGISRLLDPEDVAGPHPDERSIMTYVSLYYHYFSRLHRGQTVQKRLAK
ILQQLQETEELRERYEQLVSDLLRWIEQKESELERRDFPDSLPATRQLLAAFAAFRTEEK
PPRLRQRGAAEALLFRLRTVLRAQNRRPFVPPDGLGPGELARRWEGLERAEARRGQALQR
ELLRLGRLEQLAGRFERKAALREAFLAETEQVLGRLGPCRPANPALMEAAAKRLGALEAH
ALPQEERFRALAEISALLQQERFHGHARVARMQKQIAERWQLLREQFRERREQMEGVEEV
LGLWLEVDNLTDALKELQVPASSTACRQQLAEVVEQLQKHHLLETQISSHGASVDHLAHR
ASRPGPASGTNAEVLQARARGLTQLYQTLVSLGRARRSLLEEALRQGEFLRDCEEEESWL
RERRQLVQAAGLGRDPGQIVAALQKNKALEAEVSAHQAVGADIARKARELCQRGHPAQVD
IQERAEGIQAEWQVLRDEVAGLRARLQAALVVKQYFADAGEADSWLREQRPLLASADYGK
DEAGAEALLQRHLRLEREVRAYGLELRRLEEQARAAAGQAPLTAVLALNPTEEGPGGIGS
RRQAARRSGRRGTREITSPAEPDPHFSPGNIRKTQSDLGRDYENLRALAESRGARLRETV
ALFHFYSSCEELQSWLLDQALLFQTLQPQADDVEVVRHKYENFLTALVAGKGRLEEMGGS
AERLALACPAEAAEVRRRQLDLCQRWEQLEALKEEKGQQLVGLADVRSFLQECGHAQAHL
QTVMQQLVVVDPGSPATSPDGAHRALQLIEREILLLERKIQYLTSVAVTMKETNPAETQA
LEEQVETMQRQLDLLQEEASGRARALERARAQRRFLKESRQLLLWAEGARAQLASEEMGV
DVASANRLLREHQGLLEELRSHQESLQQLLVQGQRVAKSAPRDSPEMNGSLERLGREGRE
LEALWERRQQRLQEGLELRKFDWEADGFNATCANHEAFLRLDALGEDVEVVQRLLRRHQE
LEHLLEALGPRAESLKAHGDRLVQKQHFASPAIEEKVSSSQDRWARLQTNSGQRKRQLLA
SLQLQEWHRDAAELELWMEEKWLIAVDESYREPSNVLRKLKWHEAAESELMVNRGRVEEL
QQTGNKLVESGHDAREAVRAKLLELGRKWEKLNSKMADRGDKLRQAGQQEQLMELLQEAK
EKMEQMERGLQGAETGHDLRSSRALQKQHGQLERESQELADKMSAIIARARSVATGHFNS
ESILEETQKYLRRFESLQGPLATRRRQLQASVDLYQFYHAHDMETAWVGERMPCASSTNC
GRALDVAQNLLLKHKELQAEVTAHRVQVRRVLAAGRGVAEAGHPRARHVTERCQALDRCW
AELERACEERARQLRRSVARQQYLLDVSELEGWVPPPSRPVQSRAHSRRLINSTDCLTEL
FPCLQALEQELALYGSFVAELAQTGRGLASSHPTDELEAPQGRLQGQLRRLRELAATRGR
RLEWTLKAHEFIREAEELQDWLRGQRQAVGGGEDFGEDYEHVLHLRAKFETLQHQLAAGG
RRLAACQQLAETLLESGHGADRQISQKKHELQRAWEELWELAQGRDRALRDTEAVLKVLQ
DLTDALAHIQEKATSLPDQPARDGRGAQAQLRRHEELEHELAGSEQRLQELLDGGDEVLK
LCPPGSPAAGALREKQQAVVRSWESLRLRVGRRRSQLEQACRLARFLSQVRDYSSWAAGV
RREVQAEETTRDPGSSSLKLSAHQQLRAQLEAREEAYRAAARHGERLLQEEDAPGPQIQE
KLQMLEEERAQVFQAWKLKQDQLEAVHREQLFRRDRDHLDKILTAQEVSLKTGALGGSVE
AVEQLIRKHEAFQKLLAAQDEKETALREQAEALQGAGVQELLDSVLERRRRVKELARSRG
EALSTALLLAGFTRDVAEAEDWIRERVRQLEEPGPRDPSTLRDRLKRLKKHQAFEAEVRA
HQEVTTRVMEKGEALLARNPPGARAVRQQQRALEQRWGQLKEAVATRARELEDKRDFLEF
LQRVDQVEAWIREKEVMVSVGDLGRDHEHCLQLSRRLGEFRGASVGEPVDDAHIADINAL
AQRLQSRDPDEMKTVLQRRKQLNER
Download sequence
Identical sequences F6UP19
ENSOANP00000003132 9258.ENSOANP00000003132 ENSOANP00000003132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]