SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000004135 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000004135
Domain Number 1 Region: 23-187
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.83e-40
Family CRAL/TRIO domain 0.0033
Further Details:      
 
Domain Number 2 Region: 266-410
Classification Level Classification E-value
Superfamily PapD-like 1.94e-36
Family MSP-like 0.00000076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000004135   Gene: ENSOANG00000002601   Transcript: ENSOANT00000004136
Sequence length 476
Comment pep:novel ultracontig:OANA5:Ultra462:8032967:8075906:1 gene:ENSOANG00000002601 transcript:ENSOANT00000004136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIDESFQWRKEFMVNDMNESTLPKWVFETGAVYLHGYDKEGNKLFWFRVKFHTKDNKTLL
DKKRLIAFWLERYARREPGKPLTVMFDMAETGLSNIDMDIVRFVINCFKIYYPKYLTKIV
VFDMPWIMNAAFKIIKGWLGPDAINMLKFTSKNEVQEYVSMEYLPSHMGGTDPFKYSYPP
LVDDDFQTPLCENGPITSEDETESKEDIDTDGKEIGEPNSNEEQLPGPKKISSADTVSKP
EEPISKPEESISKPEECDKGESKTKSMKKPLSVFKGLLLHISPAEELYFGSKEIGERKCL
IMLTNVAKNTVAFKVRTTAPDKYRVKPSNSSCEPGTSLDIVVSLHGGFTVSPQDRFLIMA
AEMEQQLSGTGAAELAQFWKEVPRTKVMEHRLRCHVLESSKPSSLSLKENAFNVPTKTNE
DLYSQLTRLLDLNRKLQEQVDRCLWFQQLLTSLTVLLLSFATFCLYVLYNQRSDAL
Download sequence
Identical sequences F7E8N6
ENSOANP00000004135 ENSOANP00000004135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]