SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000005251 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000005251
Domain Number 1 Region: 438-682
Classification Level Classification E-value
Superfamily vWA-like 2.3e-67
Family Trunk domain of Sec23/24 0.00015
Further Details:      
 
Domain Number 2 Region: 187-455
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.26e-34
Family beta-sandwich domain of Sec23/24 0.0039
Further Details:      
 
Domain Number 3 Region: 889-1030
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 2.25e-33
Family C-terminal, gelsolin-like domain of Sec23/24 0.0023
Further Details:      
 
Domain Number 4 Region: 686-756
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 8.76e-21
Family beta-sandwich domain of Sec23/24 0.0055
Further Details:      
 
Domain Number 5 Region: 825-888
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 0.000000000000863
Family Helical domain of Sec23/24 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000005251   Gene: ENSOANG00000003310   Transcript: ENSOANT00000005252
Sequence length 1034
Comment pep:novel chromosome:OANA5:12:95831:195043:-1 gene:ENSOANG00000003310 transcript:ENSOANT00000005252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQGYVATPQYSQSQPGIGALSPPLYGHYGDPSQAAAPSGLMKPAGPVGATAPIGSPGP
GPQPLIQNGPPGSRPPHPRFPGLPPPSSAAFAGPPFSHPSQPPYPNPAPSSSSSSSSTTQ
LGHQLSAMHINSYGPGMAPNPQMPPGPQPATTFQGPGQPSQPTILQPGAQVLPPPPTTLN
GLGTTPPLPPLTVQNRIPGSGPPNASLQPPPLPGQAAGPGYPPQHANYGPQMPGAQLSYP
GAYPGGPTQLSGPPQPQKRLDPDSIPSPIQVIENDKATRAGQVYFTNTKGQIPPLVTTDC
VIQDQGNASPRYIRCTTYCFPASSDMAKQAQVPLAAVIKPFATIPANETPLYVVNHGETG
PVRCNRCKAYMCPYMQFIEGGRRYQCGFCSCVNEVPQFYFQHLDHMGRRLDHYEKPELSL
GSYEFVATLDYCRNNTPPNPPAYIFMIDVSYSNIKNGLVKLICEELKTVLERLPKEEQEE
TSAIRVGFVTYNKVLHFFNVKGNLAQPQMMVVTDVCEVFVPLLDGFLVNYQDSQAVIHNL
LDQIPEMFADTKDNETVFAPIVQAGMEALKAAECAGKLFIFHSSLPTAEAPGKLKNRDDR
KLLNTDKEKTLFQPQTNVYEALAKDCVASGCCVDLFLFPNQFVDVASMGLVPLLTGGSLF
KYNNFQVRADSQQFLNDLRNDIGKKIGFDAIMRVRTSTGFRATDFLGGIYMNNTTDVEMA
AVDCDKAVTVEFKHDDKLSEDSGALIQVAMIHSSFFSRASCNVEMTSFNSCKVGKGLHSC
KTDKILPAIVWAQHRYLHVIKSRLWSILNDTINRCASGLICQGVDITYHVEMTHLILPDA
MKVLPVYMNCLLKNCVLLSRPEISTDERAYQRQLVMSMGVADTQLFFYPQLLPIHTMDPT
SLTFPTAVRCSEERLSEGGVFLLANGLHMFLWLGVSTPPELIQGLFNVPSFAHINNEVTL
LPEVGNPYSEKLRTIIDVIQKKRPYSMKLTVVKQREQPEMVFRQFLVEDKGLYGGASYVD
FLCCVHKEICQLLN
Download sequence
Identical sequences F7AF04
ENSOANP00000005251 ENSOANP00000005251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]