SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000006880 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000006880
Domain Number 1 Region: 857-939
Classification Level Classification E-value
Superfamily DEATH domain 3.41e-22
Family DEATH domain, DD 0.00000964
Further Details:      
 
Domain Number 2 Region: 169-261
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000123
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 263-309
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000116
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 4 Region: 312-366
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000902
Family TSP-1 type 1 repeat 0.00062
Further Details:      
 
Domain Number 5 Region: 62-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000851
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000006880   Gene: ENSOANG00000004338   Transcript: ENSOANT00000006882
Sequence length 947
Comment pep:novel ultracontig:OANA5:Ultra28:87361:194496:-1 gene:ENSOANG00000004338 transcript:ENSOANT00000006882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPAAPSRVATVAVPPGTGGAPGVFLLAVLLLSCLPELGRAGLEFGDTLPDSFPSAPAEP
LPYFLQEPGDAYIVKNKPVELLCRASPATQIYFKCNGEWVNQNGHLTKKSLDQGTGLLVR
EVQIEVSRQQVEELFGLEDYWCQCVAWSSAGTTKSRRAYVRIAYLRKNFDQEPLGKEVPL
EHEVLLQCRPPEGVPPAEVEWLRNEDIIDPALDTNYLLTIDHNLIIRQARLADTANYTCV
AKNIVAKRRSTTATVVVYVNGGWTWSEWSSCNNRCGRGWQKRTRTCTNPAPLNGGTFCEG
PSFQKVACTTMCPVDGAWTEWSKWSACSTECTHWRSRECTAPAPQNGGRDCGGLLLDSKN
CTDGLCMQNKRVLSEPKGDLLEATGDVALYAGLVVAIFVFLVILMAVGVVVYRRGRRDFD
TNITDSSAALTGGFHPVNFKTARHNTPQLLHPSMQPDLTASAGIYRGPTCALQDPADKIP
MTTSPLLDPLPNLKIKVFSTPVVPGLPDGADLLGGVPSGPYLGEDPPFLNVRSRMLGSQT
LLGPPREHGLGASGTFGCLGGRLTVPDTGISLLVPNGAIPQGKFYEMYLIINKAENTLSG
LSLSKAAGLVLHPICAGPGFDQHPAARTLGQGGKLLNIPWPPHPSIQKFCGNGQEVVTLG
EETLNTPCFCQLEAKSCHTLLDQLGTYVFVGESCSRSAVKRLQLAIFAPALCTSLEYSLR
VYCLEDTPDALKGLFPIGLRLLSLPPLPCPFPPPVLRGSPEPTPYXQWRSKLLAKFQEIP
FCHIWSGTQKALHCTFTLERFSLASSELTCKICVRQVEGEGQIFQLHTTLAETAAGSLDA
FCSAPSVSGTTQLGPYAFKIPMSIRQKICNSLDAPNSRGNDWRLLAQKLSMDRYLNYFAT
KASPTGVILDLWEALHQDDGDLNTLAGALEEMGKSEMLVVMATEGDC
Download sequence
Identical sequences F6S3G7
ENSOANP00000006880 ENSOANP00000006880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]