SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000007799 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000007799
Domain Number 1 Region: 436-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000446
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 663-718
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000952
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 3 Region: 573-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000464
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 482-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000589
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 5 Region: 103-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000524
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number 6 Region: 726-751
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000742
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 7 Region: 526-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000643
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000007799
Domain Number - Region: 138-169
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00225
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000007799   Gene: ENSOANG00000004922   Transcript: ENSOANT00000007801
Sequence length 832
Comment pep:novel ultracontig:OANA5:Ultra337:2924421:2964119:1 gene:ENSOANG00000004922 transcript:ENSOANT00000007801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPFCAGGGRRLAGSSKTGAGKDSSRTERRLPPAQELPNIVLPSIKQGNVKAGEADIQT
LPGNVTSDKSEGRKKGRPKAENQALRDIPLGIFKENSSSHLSPSRVKCPNSGCWLEFPSI
YGLKYHYQRCQGGAISERLTYPCPYCEAAFTSKTQLEKHRLWNHMDRPVPASKPVPSSKA
VPTSKPIPTNKSGTISKPVPMGKPVHPPKPLSTSKPVPTSKLVSPNKTENRLQKTVGRSS
EALSSALGTLGRGSSGLLVWEEMTYPQFPCPATTSSNFSPPRAAESSDSSPIHPKQVKLE
KAAAQHPENGECAMETRERKDFQLPAAGTLAAAVPTTKPSCCKDSRQGGGQASFPEEDPE
RMKHRRKQKTPKKFTGEQPSISGTFGLKGLAKVEDKAKAHRAKKLEGVCSTEDSKKKPQA
SSSLSEPPRPLAESLPPSPEEQWQRIISEKGEVACPTCGVVTRKTIVGLKKHMDVCQKLQ
DALKCQHCKKQFKSKAGLNYHTMAEHVNKAVTTVETSELDEQEERERLRKVLKQMGKLKC
PNEGCMATFSSLMGYQYHQKRCGKQPSEVENPVFTCPHCGKKYKSKAGHDYHIRSEHAAP
AEEPEVKPETEVILDFERTPSGRIRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPE
TKRLNYTRPGLPTLNPQLLETWKTEVKEKGHINCPNNCCEAIYSSVSGLKAHLANCNKGG
HSVGKYRCLLCQKEFSSESGVKYHIIKTHSENWFRTAAESSPKQKHREQISPKKEKKKST
SSGKKRGRKPKERPPEASSPKSREGPAARDKASQAPLPLHSRKGGASKMPEK
Download sequence
Identical sequences F7FMA8
ENSOANP00000007799 ENSOANP00000007799 9258.ENSOANP00000007799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]