SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000008679 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000008679
Domain Number 1 Region: 262-455
Classification Level Classification E-value
Superfamily Nudix 8.8e-45
Family NADH pyrophosphatase 0.0012
Further Details:      
 
Domain Number 2 Region: 14-98
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.46e-18
Family Ankyrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000008679   Gene: ENSOANG00000005459   Transcript: ENSOANT00000008681
Sequence length 460
Comment pep:novel chromosome:OANA5:10:9750771:9761075:1 gene:ENSOANG00000005459 transcript:ENSOANT00000008681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQRNPKQKIISQFHSLAAEGDVSKLTAILSHSPDLLNKTSENGWTALMYGARNGHPDVV
QLLLEKGCDKSIVNKSRQTALDIATFWGYKHVVNLLANTKGRETPRFLPKKAEEWENYFS
KTLLDRKSEKRTNSSWLLAKQSHPATIYILFSDLSPLVTLGGNNDSSQQPEVKLCQLSHA
DVKDYLTQPDKIILVFLGVELEMKKKALNPTHGETLTEEEDEVAWFALGIDHVSAEQFKK
RHEDCYFLHPPMPALLQLKEKEAGVVAQARSVLAWHSRYSFCPTCGSATKIEEGGYKRQC
LKEDCPSLIGVHNTCYPRVDPVVIMQVLHPDGNQCLLGRQKRFPPGMFTCLAGFIEPGET
IEDAVRREVEEESGVKVGHVQYISCQPWPMPSSLMIGCLAVAISTEIKVDKNEIEDARWF
TREQVVDVLTKGNQQMFFVPPSRAIAHQLIKHWIRMNSNL
Download sequence
Identical sequences F7C2E2
ENSOANP00000008679 XP_007670013.1.37387 XP_007670017.1.37387 ENSOANP00000008679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]