SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000009581 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000009581
Domain Number 1 Region: 1128-1323
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000206
Further Details:      
 
Domain Number 2 Region: 922-1044
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-31
Family Pleckstrin-homology domain (PH domain) 0.000000954
Further Details:      
 
Domain Number 3 Region: 21-147
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-20
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000009581   Gene: ENSOANG00000006022   Transcript: ENSOANT00000009583
Sequence length 1942
Comment pep:novel ultracontig:OANA5:Ultra274:433076:513149:-1 gene:ENSOANG00000006022 transcript:ENSOANT00000009583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMYKLCIVSKNKDGKEQSEAASPSEDEPFAWPGPKTVLLKRTSQGFGFTLRHFIVYPPES
AVQFSYKDEENGSRGGKQRNRLEPMDTIFVKQVKEGGPAFEAGLCTGDRIIKVNGESVIG
KTYSQVIALIQNSDSTLELSVMPKDEDILQVLQFTKDVTALAYSQDAYLKGNEAYSGNAH
NIPEPPPILYPWIAAASSGMAEALEVSPPESSWGKQQTPAPVLTQPGRVYKMEIQVPPSP
TGIAKSNTAVCVCNETVRTVIVPSEKTVELPPSRTNHTGPSNRTEEVQYGLSDQATLKMV
SRTEQPSSSDSSVRFVHPAPGPRTGDPSGISLKPGNYGGHPDRLSNSSPQGVDSPSVATN
HYSPNSHQHIDWKNYKTYKEYIDNRRLHIGCRTIQERLDSLRAASQSTTHYSSQGVPNRT
ALQVRRRSTSHDRVPPSVQVRQRSVSQERLEDPVLMKYWPRSASQGAITSSSISFRNHRT
RSWDYLGGQGDAVENSNAEHLPPDSNGDKKQTYKWTGFTEQDDRRGIYERSRKQACHMSF
RGSNFPGPSGVFHPDGRRISGRGVGSMSPFQKGPPDKAPLQSTRDFQASCGMPPSRGISQ
DRSPLLKARSNSPKAPPIYAAKPSVNQNSFIAPHDQRPVNHLHPSNLLNQQSRLRAEGAA
DHKVDPGKPPPSSAASTKPVLPVRESSPTSGHSEVATKQKSQDFEKSPEAEMRSPDGLEN
RDTVVLREKPPSGRQTPQPLRHQSYILAVNDQDTGSDTTCWLPNDARREVHIKRIEERKA
SSSSPPGDSLASIPFIDEPTSPSVDRDIAHIPASAVISASMSQVPTLASGPPSITTSVPL
IRRQLSHDHESVGSPLLDAQSGAKTERSKSYDEGLDDYREETRLSFKPSSLKGIKVLDSQ
KSSEDSESRKDSSSEVFSDAAKEGWLHFRQLVTDKGKRVGSIRPWKQMYVVLRGHSLYLH
KDKKEQTTPSEEEQPISVNACLIDISYSETKRKNVFRLTTSDHEYLFQAEDRDDMLAWIK
TIQESSNLNEEDTGVTNRDLISRRIKEYSSLMSSKTEPLTKTPRPSIRQTLLGTKSEPKT
QSPHSPKEESERKLLSKDETSPPKGTWRKGIPNIMRKTFEKKPTAAATFGVRLDDCPPAH
NNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISNLQEELNKGMVDIDIHDEKWRDL
NVISSLLKSFFRKLPEPLFTNDKYADFIDANRKENPLERLKTLKRLIHDLPDHHYQTLKF
LSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTNMVTHMPDQYKIVETLIQHHD
WFFTEEGAEEPLTTVQEENTVESQPVPNIDHLLTNIGRTGVSPGDVSDSATSDTAKSKGS
WGSGKDQYSRELLVSSIFAAASRKRKKTKEKAQPSSSEDELDNVFFKKEIAEQSHGDAIK
KDGDGLGRKQRVLISKESSTKKDQHGAKDKKMSLRKGSTGSEEPSPPYNSKHAKSPNLSC
RLTAPRGDPKTPVPQTSSQLEETVSDSGTLLSTSSQTSLPRFSSKKLTSPEMKRGEFFAN
VTSDYSTASSTTYQAGLDSSRLSPEVQSVAESKGDEADDERSELVSEGRPVETDSESEFS
IFTPSFASDRAFRAKMQETTKTSRRNSEGSEVNCTEGSLTPNLDGRRQQFSSHKLIECDT
LSRRKSARIKSDSEGLGDGKMERETPSVTKMFDVMKKGKSTGSLVMSARSESEKQEPTWR
IKITDRLKLRLKASADDMFGIGSQKASSVESAKRKNIRRRHTLGGQRDFAEISVLNAWKV
HEESPSREREYELSAVNRLKPKCPAQDLSISDWLARERLRTSTSDLNAGESGDPRLENPS
RADVSGADLPLSAQLRADESSSPSTLTLASRPCLSAPLQAPDQINGESFQNMNKNNFSAA
VDAHPHKLSGTQVVKSRFYQYL
Download sequence
Identical sequences F6V5R4
ENSOANP00000009581 9258.ENSOANP00000009581 ENSOANP00000009581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]