SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000009594 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000009594
Domain Number 1 Region: 167-266
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.03e-32
Family Ras-binding domain, RBD 0.0021
Further Details:      
 
Domain Number 2 Region: 309-417
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-16
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000009594   Gene: ENSOANG00000006030   Transcript: ENSOANT00000009596
Sequence length 649
Comment pep:novel ultracontig:OANA5:Ultra274:1347928:1442223:1 gene:ENSOANG00000006030 transcript:ENSOANT00000009596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEANEDIEQMFSNLLGEMDLLTQSLGVETLPPPPKPPNTEFNYSVGFKDLSESLNALED
KDLDALMADLVADISEAEQRTIEAQKQSAQGQPSAASQPRPDQSVAAPLSCKPYVAAPGT
SLYYEDDLPPPPADPILDLPPPPPEPLSKEDEEAQAKSDKIKLALEKLKEAKVKKLVVKV
HMNDNSTKSLMLDERQTARDVLDNLFEKTHCNCNVEWCLYEKYPELQIERFFEDHENVVE
ILTDWTRDTENKVLFLEKDEKYAVFKNPQNFYLANKGKKEGKDSNEKMNSKNKEALLEES
FCGTSVIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFENV
NIYYGTQCKVKYKAPTDHCFVLKHPQIQKESHYIKYLCCDDLWTLNQWITGIRIAKYGRT
LYDNYQRAVEKAGLAARWSNLGTGDPAATTQSPTTGPGQPNGQIPQTTHSVSSVLQEAQQ
DFNVAKEPNVAGDCNPPAPMVKHPKKSALLPPPPPQRRSSDTSCLSLGPSKPQNAGMGNP
SNLEDFPLPPPLLEDELPPPPPDFIDEPPSFIPPPPPSLAVGGLPSPPPPPPPPPSAVSR
ENLAPLRKRPPAPPKRQEQVGEPNRGPGGEADFMSDLMKALQKKRGNIS
Download sequence
Identical sequences F6V521
ENSOANP00000009594 XP_007665943.1.37387 XP_007665944.1.37387 XP_007665945.1.37387 ENSOANP00000009594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]