SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000012025 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000012025
Domain Number 1 Region: 171-244
Classification Level Classification E-value
Superfamily Homeodomain-like 4.28e-18
Family Homeodomain 0.0000547
Further Details:      
 
Domain Number 2 Region: 53-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000309
Family LIM domain 0.022
Further Details:      
 
Domain Number 3 Region: 22-52
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000977
Family LIM domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000012025   Gene: ENSOANG00000007547   Transcript: ENSOANT00000012027
Sequence length 359
Comment pep:novel chromosome:OANA5:5:1277597:1355191:-1 gene:ENSOANG00000007547 transcript:ENSOANT00000012027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDIIFHYPFLGAMGDHSKKKPGIAMCVGCGSQIHDQYILKVSPDLEWHAACLKCAECSQ
YLDETCTCFVRDGKTYCKRDYIRLFGIKCAHTHTHFGPALKAHPVDVLRYVAASWVEIRP
RRPPISDCSITLRPSLCPSAPFGTLSGQSGTGWSRGPGPGPGPPADPGSGRQPSLRPHVH
KQAEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCK
DKKKSILMKQLQQQQHNDKTCGGGVRGRDSQASSPSSPASSSYRRGPGLPVAALLRGRGR
GCALRILSGLSTLHRLSLRSQVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET
Download sequence
Identical sequences F6SPX8
9258.ENSOANP00000012025 ENSOANP00000012025 ENSOANP00000012025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]