SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000013451 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000013451
Domain Number 1 Region: 167-265
Classification Level Classification E-value
Superfamily ADP-ribosylation 4.41e-21
Family Tpt1/KptA 0.092
Further Details:      
 
Domain Number 2 Region: 51-138
Classification Level Classification E-value
Superfamily WWE domain 5.76e-16
Family WWE domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000013451   Gene: ENSOANG00000008460   Transcript: ENSOANT00000013454
Sequence length 283
Comment pep:novel supercontig:OANA5:Contig2897:54305:61407:-1 gene:ENSOANG00000008460 transcript:ENSOANT00000013454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAIEKAYCDPGKNRLLVSGPVGRVASLNFEDMSWDSTRARRLSTASSLTKPPHFILTTD
WLWFWEDELGQWREYGMEGPKRSTASISSQDLEKAYLDGTAPTLQFKAGNHTYEFDFKAM
VQKNLYYGTKRKVCRRPRFISEGDVVKKQKRNNIPAHWDRSALPDPGYKLIPLDASSEEY
QKVQGLFQRTVPKLYIWSIQRIQNVALWQVFQWQKEQMRKSNGGQEVDERQLFHGTSQKH
VDAICEQNFDWRICGLHGTAYGRGSALPLPARHPLSLGHHPPQ
Download sequence
Identical sequences F6PJ90
ENSOANP00000013451 ENSOANP00000013451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]