SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000019630 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000019630
Domain Number 1 Region: 12-195
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.53e-72
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000493
Further Details:      
 
Domain Number 2 Region: 190-315
Classification Level Classification E-value
Superfamily E set domains 1.82e-45
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000019630   Gene: ENSOANG00000012405   Transcript: ENSOANT00000019633
Sequence length 600
Comment pep:novel ultracontig:OANA5:Ultra56:3824396:3856136:1 gene:ENSOANG00000012405 transcript:ENSOANT00000019633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISAQQPPGGRGPYVEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDSNRTYPSIQIMNS
YGRGKGKVRITLVTKNEPYKPHPHDLVGKDCRDGYYEAEFGQDRRALCFQNLGIRCVKKK
EVKEAIISRIATEINPFNVPEEQLLNIEDCDLNVVRLCFQVFLLDEHGNLTSALPPVVSN
PIYDNRAPNTAELRICRVNRNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGSFSQ
ADVHRQVAIVFRTPPYNKVITEPVTVKMQLRRPSDQEVSDPMDFRYLPDEKDPYGNKAKK
QRTPLTLQKLLHSYGPSISERPKACPPRPPGDLTGVRMIKKEPNLISQVAPLTEMHRTSS
GTTNQIASYYPPSISNPNTISHHASNIRPLIHGSSSNWSSLTLPVTPPNSFSSATLHPNS
QGHQSFPEMSNHLSSVGSNPCLYMDTNGTDGIGNLPIPQTDVFSASNSTMLPNHPMNSTA
PSNDGDMETDDLRFLSMNLEPQSYPMLSTKDYRRQMHQMPSTSVSTHGSCAAPFVSQSEA
FDSVNLSCLNSSILNESPASNHPNPNNHSYDQSNQYYVTDGLQSEDHYNSFEVNLDFFNS
Download sequence
Identical sequences F7DUB3
ENSOANP00000019630 XP_007670230.1.37387 ENSOANP00000019630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]