SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000020915 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000020915
Domain Number 1 Region: 75-181
Classification Level Classification E-value
Superfamily WWE domain 1.31e-32
Family WWE domain 0.00000147
Further Details:      
 
Domain Number 2 Region: 35-81
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000283
Family RING finger domain, C3HC4 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000020915   Gene: ENSOANG00000013241   Transcript: ENSOANT00000020918
Sequence length 229
Comment pep:novel chromosome:OANA5:2:42317252:42317938:-1 gene:ENSOANG00000013241 transcript:ENSOANT00000020918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRGEVDHPVNMLPVDGKGDESRPDAAPSLPVPECAICLQTCVHPVSLPCKHVFCYLCV
KGASWLGKRCALCRQEIPEDFLDRPTLLSPEELKAAGRGNGEYAWYYEGRNGWWQYDERT
SRELEDAFSRGKKSTEMLIAGFLYVADLENMMQYRRNEHGRRRKIKRDVVDIPKKGVAGL
RLDCEPNGVSPARESSADGADGTSARGGAPPPPPAPSPAPSRPPTALDG
Download sequence
Identical sequences F6UT00
9258.ENSOANP00000020915 ENSOANP00000020915 ENSOANP00000020915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]