SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000020980 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000020980
Domain Number 1 Region: 234-296
Classification Level Classification E-value
Superfamily Homeodomain-like 2.05e-20
Family Homeodomain 0.0033
Further Details:      
 
Domain Number 2 Region: 116-182
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000183
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 84-114
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000222
Family LIM domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000020980   Gene: ENSOANG00000013288   Transcript: ENSOANT00000020983
Sequence length 361
Comment pep:novel supercontig:OANA5:Contig919:205150:231053:-1 gene:ENSOANG00000013288 transcript:ENSOANT00000020983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYWKSDQMFVCKLEDKDVPELDVSSEKFPGLMSEECGRSAAALAAGRSRKGAGEGGLVSP
EGAGDEDSCSSSAPLSPSSSPRSMAKCVCSSCGLEIVDKYLLKVNDLCWHVRCLSCSVCR
TSLGRHTSCYIKDKDIFCKLDYFRRYGTRCSRCGRHIHSTDWVRRAKGNVYHLACFACFS
CKRQLSTGEEFALVEEKVLCRVHYDCMLDNLKREVENGNGISVEGALLTEQDVNHPKPAK
RARTSFTADQLQVMQAQFAQDNNPDAQTLQKLAERTGLSRRVIQVWFQNCRARHKKHVSP
NHSSTAPVTAVQPSRLSPPMLEEMTYSAYVPQDGTMLTALHSYMDGSHQQLLDSSPCYPI
R
Download sequence
Identical sequences F6S4Y5
9258.ENSOANP00000020980 ENSOANP00000020980 ENSOANP00000020980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]