SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000021010 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000021010
Domain Number 1 Region: 183-306
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 8.37e-61
Family Dystroglycan, domain 2 0.000000463
Further Details:      
 
Domain Number 2 Region: 500-602
Classification Level Classification E-value
Superfamily Cadherin-like 2.35e-19
Family Dystroglycan, N-terminal domain 0.015
Further Details:      
 
Domain Number 3 Region: 63-161
Classification Level Classification E-value
Superfamily Cadherin-like 1.52e-18
Family Dystroglycan, N-terminal domain 0.000009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000021010   Gene: ENSOANG00000013307   Transcript: ENSOANT00000021013
Sequence length 898
Comment pep:novel supercontig:OANA5:Contig861:97678:193080:1 gene:ENSOANG00000013307 transcript:ENSOANT00000021013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMTVGFILLPPLWGRTFFMVLLWAADVRSHWPSEPSEVIRDWENQLEASMHSVLSDLRE
TVPAVVGIPDGIAVVGRLFRVAIPTDLIASNGETIKMSEAGKDTLPSWLHWEPETRMLEG
LPLDTDKGVHYISVNAMQLASNGSYVPQATNVFSIEVYPEDHNEPQSVRVASQDLNEAVP
FVCGADEPVTILTVILDADLTKMTPKQRVELLNRMRSFSEVELHNMKLVPVVNNRLFDMS
AFMAGPGNAKKVVENGALLSWKLGCSLNQNSVPNISSVEAPAKEGTMSAQLGYPVVGWHI
ANKKPHLPKRIRRQINATPTPVTAIGPPTTALQEPPTRIVPTPTSPAIAPPTETTAPPVR
DPVPGKPTVTIRTRGAIVQTPTLGPIQPTRVVETTSTVPGQIRPTMTIPGYVEPTAVATP
PSTTTKKPRITTLKPATPSTTDSSTTTTTRRPTKKPRTPRPPPRVTTKAPITKLETASPP
TRIRTTTSGPPRVSEPNQPPELKNHIDRVDAWVGTYFEVKIPSDTFYDKEDTTTDKLKLT
LKLREQQMVGEKSWVQFNSNSQLMYGLPDNNHVGKHEYFMHATDKGGLSAVDAFEIHVHK
RPHGDKAPAHFKARFQGDPASVVDDIQKKITLVKKLAFAFGDRNSSTITLQNITRGSIVV
EWTNNTLPLDPCPKEQIQSMSKRISEDDGKPRPVFSNALDPDFSALSISVMGSGSCRHIQ
FIPVTAVRRVPSEAPPTVVTEKDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRK
KRKGKLTIEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQNMP
ETTPLNQDTIGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences F7EE53
XP_001509725.2.37387 9258.ENSOANP00000021010 ENSOANP00000021010 ENSOANP00000021010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]