SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000027166 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000027166
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.93e-45
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000177
Further Details:      
 
Domain Number 2 Region: 120-220
Classification Level Classification E-value
Superfamily E set domains 3.11e-29
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000027166   Gene: ENSOANG00000021344   Transcript: ENSOANT00000030966
Sequence length 648
Comment pep:novel chromosome:OANA5:X1:42758478:42825637:1 gene:ENSOANG00000021344 transcript:ENSOANT00000030966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFIGTADDRYLRPHAFYQVHRITGKTVATASQEMIIASTKVLEIPLLPENSMSASIDCAG
ILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPSGKVLSLQTASIPVECSQRSAQEL
PQIEKYNINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPQWEVEGKIIREKCQGAN
IVLEVPPYHNKTVTAAVQVQFYLCNGKRKKSQSQRFTYTPVLMKQEHREEMDLAPIPSLS
LPQNGGIRGLHPIRTQLPPSESGNPHDNLLSTSPRSLVCPIQPPYPSMITSPVAHLPHMQ
SRNISPGEECHIMPSVVVHQAFQVTAAPPVGSSYQPMQSNVMYNGQACLPINTASHPAFD
TISFQQDAAVPHLINLGCQPLPPIQYHPSNPGPLPTATLAPRHALGPPSCSEQASPHFPP
MGYQCPSAGSGPISSASPSQAVGQVPSQLQPGAYHPSNPGPTTSASPTASHPLVCSPLSG
PPSPQLQPMPYQSPSSGPVSSPSPTTVTHSRQHSPQAHSPGLGSLSAPSSLVCHRLCDSS
PFSSDGATLNIKPEPEDQELNFETIGLQDITLDDDHFISDLEYQPPGPAETWVQQSALIS
NSFLENLEVNEIIGRDMSQISVSQGATGTSQSSHECPSSLDSGLSDGV
Download sequence
Identical sequences F6S104
ENSOANP00000027166 XP_007653661.1.37387 XP_007653663.1.37387 ENSOANP00000027166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]