SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000031225 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000031225
Domain Number 1 Region: 21-99
Classification Level Classification E-value
Superfamily WWE domain 2.35e-20
Family WWE domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000031225   Gene: ENSOANG00000029508   Transcript: ENSOANT00000040470
Sequence length 107
Comment pep:novel supercontig:OANA5:Contig6065:17031:18946:1 gene:ENSOANG00000029508 transcript:ENSOANT00000040470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVYETAEFDQVRRLSTPSCTTANSNYHTVWKYFCRDHFGWREYSEPVVRLIEEANCRGL
KEVRFVMWHNQYILNIKDGFQQNSCFRREIKKRPLLRSCIVLMPYLQ
Download sequence
Identical sequences K7ECG8
ENSOANP00000031225 ENSOANP00000031225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]