SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000000061 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000000061
Domain Number 1 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.91e-26
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 346-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.37e-26
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.05e-24
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 542-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 402-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.84e-24
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 290-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 588-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 252-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-16
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 9 Region: 449-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000515
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000000061   Gene: ENSOCUG00000000071   Transcript: ENSOCUT00000000071
Sequence length 648
Comment pep:novel scaffold:oryCun2:GL018786:978040:986193:-1 gene:ENSOCUG00000000071 transcript:ENSOCUT00000000071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGSLSFKDVTVDFTQEEWQHLDPAQKTLYMDVMLENYCHLISVGCHMTKPDVILKLERGE
EPWTSFLGHTLEENWKTEDFLVKFKEHKDKYSRSIVCINHKKPIKEKSNIYEKSKSIILG
KNSVDSKILPPEYDTHGKILESVSELIIGNLSPARKRLSEYNGYGNSLLSTKQEKAHPQV
RSHNQNARAFNHNEGLMQYQKMGTPAQSFGYDESEKSFLKRGGLVTVTHNRAYRGENSSV
FNKKRRATNIEKKHTCSECGKSFCRKSVLILHQGIHTEEKPYQCHQCGNAFRRKSYLIDH
QRTHTGEKPFVCNECGKSFRLKTALTDHQRTHTGEKSYECPQCRNAFRLKSHLIRHQRTH
TGEKPYECNDCGKSFRQKTTLSLHQRIHTGEKPYICKECGKSFHQKANLTVHQRTHTGEK
PYICNECGKSFSQKTTLALHEKTHNEEKPYICNECGKSFRQKTTLVAHQRTHTGEKSYEC
PHCGKAFRMKSYLIDHHRTHTGEKPYECNECGKSFSQKTNLNLHQRIHTGEKPYICNECG
KSFRQKATLTVHQKIHTGQKSYECPQCGKAFSRKSYLIHHQRTHTGEKPYKCNECGKCFR
QKTNLIVHQRTHTGEKPYVCNECGKSFSYKRNLIVHQRTHKAENMEMQ
Download sequence
Identical sequences 9986.ENSOCUP00000000061 ENSOCUP00000000061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]