SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000000334 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000000334
Domain Number 1 Region: 3-226
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.11e-55
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0036
Further Details:      
 
Domain Number 2 Region: 298-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.39e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000000334   Gene: ENSOCUG00000000379   Transcript: ENSOCUT00000000380
Sequence length 539
Comment pep:novel chromosome:oryCun2:13:26314423:26355745:-1 gene:ENSOCUG00000000379 transcript:ENSOCUT00000000380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKRIAVIGAGISGLGAIKCCLEEDLEPTCFERNDDIGGLWKFQRNTSEKMPSIYKSVT
INTSKEMMCFSDFPIPDHFPNYMHNSKVMDYFKMYAKHFDLLSYIRFKTEVRSVRKHPDF
SFSGQWDVIVESDGKQETLVFDGILVCSGHHTDPYLPLQSFPGIEKFKGYYFHSREYKSP
EEFSEKRIIVVGIGNSGVDIAVELSHVAKQVFLSTRRGSWILHRVWDNGYPMDSLLFTRF
NTFLKKIITTASTNNHLEKILNSRFNHALYGLQPQHRFLSQHPTVSDDLPNHIISGKVQV
KPNVTEFTETDAIFDDGTVEENIDVVIFATGYSFSFPFLDDLVKVSNNEVSLYKLMFPPD
LEKPTLAIIGLIQPLGIVLPIAELQSRWAVRVFKGLSNLPSMKTMMADIAQRKRDMEKRY
VKTPRHTIQVDHIEYMDEIAALVGVKPNLLLLFLSDPKLAMEVFFGPCTPYQYRLQGPGK
WDGARRAILTQRERIIKPLKTRVTSEDCQSSSQHFSRKLVPLGLAFLAAALTYFRYIHQ
Download sequence
Identical sequences G1SD65
ENSOCUP00000000334 ENSOCUP00000000334 9986.ENSOCUP00000000334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]