SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000000348 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000000348
Domain Number 1 Region: 790-870
Classification Level Classification E-value
Superfamily DEATH domain 1.65e-19
Family DEATH domain, DD 0.00014
Further Details:      
 
Domain Number 2 Region: 218-268
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000405
Family TSP-1 type 1 repeat 0.0005
Further Details:      
 
Domain Number 3 Region: 131-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000107
Family I set domains 0.042
Further Details:      
 
Domain Number 4 Region: 272-326
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000693
Family TSP-1 type 1 repeat 0.00058
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000000348
Domain Number - Region: 14-56
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000366
Family I set domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000000348   Gene: ENSOCUG00000000398   Transcript: ENSOCUT00000000397
Sequence length 880
Comment pep:novel chromosome:oryCun2:3:57347549:57362599:1 gene:ENSOCUG00000000398 transcript:ENSOCUT00000000397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPNPVPGANPELLPHFLVEPEDVYIVKNKPVLLVCKATPATQIFFKCNGEWVRQVDHAIE
RSTDSSSANDPREIGVRRRRSWKQTAFSHSWGHWFWLQTGGGGWGAGISQRGRQRGSRAV
LANLRKNFELEPLAKEVSLEQGIVLPCRPPEGVPPAEVEWLRNEDLVDPALDPNVYITRE
HSLVVRQARLADTANYTCVAKNIVARRRSASAAVIVYVNGGWSTWTEWSACSASCGRGWQ
KRSRSCTNPAPLNGGAFCEGQNVQKTACATLCPVDGSWSPWSKWSACGLDCTHWRSRECS
DPAPRNGGEECQGADLDTRNCTSDLCVHIKNLIICVNSFLMAASGPEDVALYVGLIAVAV
CLVLLLLVLILVYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTT
TTYQDGPSPKFQLTNGHLLSPLSGGRHTLHHSSPTAEAEDFVSRLSTQNYFRSLPRGTSN
MAYGTFNFLGGRLMIPNTGISLLIPPDAIPRGKIYEIYLTLHKPEDVRLPLAGCQTLLSP
IVSCGPPGVLLTRPVILAMDHCGEPSPDSWSLRLKKQSCEGSWEDVLHLGEESPSHLYYC
QLEAGACYVFTEQLGRFALVGEALSVAAAKRLKLLLFAPVACTSLEYNIRVYCLHDTHDA
LKEVVQLEKQLGGQLIQEPRLLHFKDSYHNLRLSVHDVPSSLWKSKLLVSYQEIPFYHIW
NGTQQYLHCTFTWITDNLNNSDISQRNKTKLVETIFIAILIHTGIFDTRFAELLALESEG
GVPALVGPSAFKIPFLIRQKIITSLDPPCSRGADWRTLAQKLHLDSHLSFFASKPSPTAM
ILNLWEARHFPNGNLSQLAAAVAGLGQPEAGLFTVSEAEC
Download sequence
Identical sequences G1SD78
9986.ENSOCUP00000000348 ENSOCUP00000000348 ENSOCUP00000000348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]