SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000000418 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000000418
Domain Number 1 Region: 25-347,463-509
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.53e-61
Family FAD-linked reductases, N-terminal domain 0.0086
Further Details:      
 
Domain Number 2 Region: 327-450
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 7.2e-30
Family L-aminoacid/polyamine oxidase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000000418   Gene: ENSOCUG00000000479   Transcript: ENSOCUT00000000480
Sequence length 522
Comment pep:known chromosome:oryCun2:18:69675253:69681895:-1 gene:ENSOCUG00000000479 transcript:ENSOCUT00000000480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRVCEWRGQGSGGGVGRGQVRGGPVQVLVVGGGIAGLGAAQRLCRHPASPHLRVLEATAR
AGGRIRSERSFGGVVEVGAHWIHGPSQGNPVFQLAARYGLLGERELSEENQLLETGGHVG
LPSVCYSSSGACVSLQLVAEMASLFYGLIDQTREFLHSTKTPVPSVGDFLKREIGQLAAG
WTEDEDTRKLKLAILNTFLNVECCVSGTHSMDLVALAPFGEYTVLPGLDCTFAGGYQGLT
DHLVASLPKDVMVFNKPVKTVHWAGAFQEAASPGETFPVLVECEDGDRLPAHHVIITVPL
GFLKERLDTFFVPPLPPDKAEAVKKMGFGTNNKIFLEFEEPFWEPACQHIQLVWEDSSPL
QDAAPVLPDTWYRKLIGFLVLPPCGSVHVLCGFIAGLESEFMETLSDEEVLTSLTHVLRK
ATGNPELPAPKSVLRSRWHSAPYTRGSYSYVAVGSTGDDIDLLAQPLPADSAGAQLQVLF
AGEATHRTFYSTTHGALLSGWREADRLAGLWEPQAPRPWPRL
Download sequence
Identical sequences G1SDD7
ENSOCUP00000000418 ENSOCUP00000000418 9986.ENSOCUP00000000418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]