SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000001084 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000001084
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily DEATH domain 6.59e-24
Family Caspase recruitment domain, CARD 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000001084   Gene: ENSOCUG00000001251   Transcript: ENSOCUT00000001251
Sequence length 144
Comment pep:novel chromosome:oryCun2:4:72977654:72978738:1 gene:ENSOCUG00000001251 transcript:ENSOCUT00000001251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARDKQVLRSHRLELGAEVLVEGLVLQYLYQEGILTENHVQEIQAQATGLRKTMLLLDI
LPSRGPKAFDAFLDSLKEFPWVREKLQKAREEAATELPAGRPPQVSSRQLLKAYLIAGRR
CYTKHLFPPNISRVYTFSETEGQR
Download sequence
Identical sequences G1SF24
9986.ENSOCUP00000001084 ENSOCUP00000001084 ENSOCUP00000001084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]