SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000001122 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000001122
Domain Number 1 Region: 388-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.04e-36
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 
Domain Number 2 Region: 85-241,387-437
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.04e-18
Family FAD/NAD-linked reductases, N-terminal and central domains 0.059
Further Details:      
 
Domain Number 3 Region: 748-780
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000385
Family LIM domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000001122
Domain Number - Region: 781-811
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0214
Family LIM domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000001122   Gene: ENSOCUG00000001299   Transcript: ENSOCUT00000001301
Sequence length 963
Comment pep:novel chromosome:oryCun2:1:153891563:153983151:1 gene:ENSOCUG00000001299 transcript:ENSOCUT00000001301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGENEDEKQAQAGQVFENFVQASTCKGTLQAFNILTRQLDLDPLDHRNFYSKLKSKVNTW
KAKALWYKLDKRGSHKEYKRGKSCMNTKCLIIGGGPCGLRTAIELAFLGAKVVVVEKRDT
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEIHVN
VEFVKVLEPPEDQENQKIGWRAEFLPADHALSNFEFNVIIGADGRRNTLEGFRRKEFRGK
LAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDCTHYFV
MTAKKQSLIDKGVIIKDYVDTEMLLCAENVNQDNLLSYAREAADFATNYQLPSLDFAMNH
YGQPDVAMFDFTSMYASENAALVRERQAHQLLVALVGDSLLEPFWPMGTGCARGFLAAFD
TAWMVKGWDQGTPALELLAERESLYRLLPQTTPENINKNFEQYTLDPGTRYPNLNSNCVR
PHQVKHLFITKELDRYPLERLGSVRRTVGLSRRESDIRPSKLLTWCQQQTEGYQHVNVTD
LTTSWRSGLALCAIIHRFRPELINFDSLNEDDAVENNQLAFDVAEREFGFPPVTTGKEMA
SAQVPDKLSMVMYLSKFYELFRGAPLRPVDSWRKNYGENADFSLAKSSIPNNYLNLTLPR
KRTPRVDGQPEENDMNKRRRKGVNNVDEPPAFSSRSLGSSQECGSSKEGGSQNKVKSMAN
QLLAKFEESTRNPSLLKQESMRKAFPLSVGGSDTCYFCKKRVYVMERLSAEGHFFHRECF
RCSICDTTLRVATYAFDCDEAGKFYCKPHFIHCKTNSKQRKRRAELKQQREEEGTWQEQD
TPQRDTPTESSCAAAAIGTPEGSPPGISTSFFRRALAWPLRLPGALLDIPRGLLNWIRGL
LRAVGLHVRDNAHNYCYTYELLSLGLPLLWAFSEVLAAMYRESEESLESLRSWVLRCIPA
KLH
Download sequence
Identical sequences ENSOCUP00000001122 9986.ENSOCUP00000001122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]