SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000001207 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000001207
Domain Number 1 Region: 61-375
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 6.41e-103
Family Protein prenylyltransferase 0.0000000000116
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000001207
Domain Number - Region: 16-83
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0915
Family beta-sandwich domain of Sec23/24 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000001207   Gene: ENSOCUG00000001402   Transcript: ENSOCUT00000001402
Sequence length 380
Comment pep:novel scaffold:oryCun2:GL018706:364533:396098:-1 gene:ENSOCUG00000001402 transcript:ENSOCUT00000001402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATEGVGEAAAGGEAGQPEQPPPQPHPPPAQLQQQGEEMAAEAGEAVPSPMDDGFLSLD
SPTYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKL
TRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWL
KDPSQELEFIADILNQDAKNYHAWQHRQWVIQEYKLWDNELQYVDQLLKEDVRNNSVWNQ
RYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQL
LDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYI
GRSLQSKHSTESALPTDVQQ
Download sequence
Identical sequences G1SFC8
9986.ENSOCUP00000001207 ENSOCUP00000001207 XP_008272126.1.1745 ENSOCUP00000001207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]